washingmachinerepairsyeovil.com washingmachinerepairsyeovil.com

WASHINGMACHINEREPAIRSYEOVIL.COM

Yeovil Washing Machine Repairs

Yeovil Washing Machine Repairs. 2 Welbeck Road -. Washing Machine Rentals 5 p/w. Short term contracts minimum 4 months. If you are looking for a first-class service, you have come to the right place! We aim to be friendly and approachable. We are here to serve you and answer any questions you may have. Call us today: 07940912543. We put our customers first. We listen to you and help you find what is the best solution to repair your. Refurbished Washing Machines From 75.00. Delivery Locally e.g Yeovil.

http://www.washingmachinerepairsyeovil.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR WASHINGMACHINEREPAIRSYEOVIL.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

October

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Saturday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 4.0 out of 5 with 13 reviews
5 star
4
4 star
5
3 star
4
2 star
0
1 star
0

Hey there! Start your review of washingmachinerepairsyeovil.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

0.8 seconds

CONTACTS AT WASHINGMACHINEREPAIRSYEOVIL.COM

ACE WASHING MACHINE REPAIRS

DAVID NARDIELLO

2 WELB●●●●●●YEOVIL

SOM●●●SET , BA21 5PH

GB

44.01●●●●●23567
44.07●●●●●12543
NA●●●●●●●@TISCALI.CO.UK

View this contact

ACE WASHING MACHINE REPAIRS

DAVID NARDIELLO

2 WELB●●●●●●YEOVIL

SOM●●●SET , BA21 5PH

GB

44.01●●●●●23567
44.07●●●●●12543
NA●●●●●●●@TISCALI.CO.UK

View this contact

JUSTHOST.COM

JUST HOST HOSTING

1958 S●●●●●●0 EAST

PR●●VO , UTAH, 84606

US

1.88●●●●7585
WH●●●@JUSTHOST.COM

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
2012 January 13
UPDATED
2014 January 12
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 13

    YEARS

  • 9

    MONTHS

  • 16

    DAYS

NAME SERVERS

1
ns1.justhost.com
2
ns2.justhost.com

REGISTRAR

ENOM, INC.

ENOM, INC.

WHOIS : whois.enom.com

REFERRED : http://www.enom.com

CONTENT

SCORE

6.2

PAGE TITLE
Yeovil Washing Machine Repairs | washingmachinerepairsyeovil.com Reviews
<META>
DESCRIPTION
Yeovil Washing Machine Repairs. 2 Welbeck Road -. Washing Machine Rentals 5 p/w. Short term contracts minimum 4 months. If you are looking for a first-class service, you have come to the right place! We aim to be friendly and approachable. We are here to serve you and answer any questions you may have. Call us today: 07940912543. We put our customers first. We listen to you and help you find what is the best solution to repair your. Refurbished Washing Machines From 75.00. Delivery Locally e.g Yeovil.
<META>
KEYWORDS
1 yeovil
2 somerset
3 sales@washingmachinerepairsyeovil com
4 about us
5 find us
6 blog
7 washing machine
8 tumble dryers
9 dishwashers
10 cookers
CONTENT
Page content here
KEYWORDS ON
PAGE
yeovil,somerset,sales@washingmachinerepairsyeovil com,about us,find us,blog,washing machine,tumble dryers,dishwashers,cookers,free,industry leading products,quick turnaround,friendly and approachable,pay your bill,donation amount,currency gbp,show on wall
SERVER
Apache
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Yeovil Washing Machine Repairs | washingmachinerepairsyeovil.com Reviews

https://washingmachinerepairsyeovil.com

Yeovil Washing Machine Repairs. 2 Welbeck Road -. Washing Machine Rentals 5 p/w. Short term contracts minimum 4 months. If you are looking for a first-class service, you have come to the right place! We aim to be friendly and approachable. We are here to serve you and answer any questions you may have. Call us today: 07940912543. We put our customers first. We listen to you and help you find what is the best solution to repair your. Refurbished Washing Machines From 75.00. Delivery Locally e.g Yeovil.

INTERNAL PAGES

washingmachinerepairsyeovil.com washingmachinerepairsyeovil.com
1

Blog | Yeovil Washing Machine Repairs

http://www.washingmachinerepairsyeovil.com/blog

Yeovil Washing Machine Repairs. 2 Welbeck Road -. You don't have any blog posts yet. Create one and it will display here! Put my Donation on the Recognition Wall. Do not show any information. Donation Amount, User Details and Comments. User Details and Comments Only. Write your comment within 199 characters. Price Estimates via E-mail. Find more information about us. Contact us for help or a quote. Call Us or send us a quick Email. Developed by Yeovil Web Design.

2

Find Us | Yeovil Washing Machine Repairs

http://www.washingmachinerepairsyeovil.com/find-us

Yeovil Washing Machine Repairs. 2 Welbeck Road -. Directions to Yeovil Washing Machine Repairs. Call Us Now: 07940912543. We are located in the Welbeck Road. Put my Donation on the Recognition Wall. Do not show any information. Donation Amount, User Details and Comments. User Details and Comments Only. Write your comment within 199 characters. Price Estimates via E-mail. Find more information about us. Contact us for help or a quote. Call Us or send us a quick Email. Developed by Yeovil Web Design.

3

About Us | Yeovil Washing Machine Repairs

http://www.washingmachinerepairsyeovil.com/about-us

Yeovil Washing Machine Repairs. 2 Welbeck Road -. We are the fixed-price appliance repair specialist. On this website you can book repairs for all your washing machine, tumble dryers, cookers appliances including dishwashers. We operate in Yeovil and the surrounding areas. Who Are Washing Machine Repairs Yeovil? WashingMachineRepairsYeovil was launched in 1996 by myself and has grown massively in the last 18 years. Put my Donation on the Recognition Wall. Do not show any information.

UPGRADE TO PREMIUM TO VIEW 0 MORE

TOTAL PAGES IN THIS WEBSITE

3

OTHER SITES

washingmachinerepairswigan.co.uk washingmachinerepairswigan.co.uk

Ashton Electric domestic appliance engineers

Ashton Electric Information and areas we cover]. The Premier Domestic Appliance Repair Service for the Wigan, Ashton and St Helens area. NO CALL OUT CHARGE. PLEASE CALL OUR SERVICE TELEPHONE NUMBER. 9am to 5pm Monday to Friday. 10am to 1pm Saturday. In Your Home Repairs and Service. All makes and models of domestic appliance. WASHING MACHINES, TUMBLE DRYERS, DISHWASHERS,. ELECTRIC COOKERS and OVENS ETC (Not Refrigeration). A call out charge may apply to some integrated appliances.

washingmachinerepairswirral.com washingmachinerepairswirral.com

Wirral Appliance Repairs, local engineer:Paul

Washtec Appliance Repairs Wirral. Paul the appliance engineer. I am a time served electrician. Makes and areas covered include :. Competitive prices and all repairs are Guaranteed. Reliable and Honest with over 25 years experience in the trade. Fully insured and approved to carry out repairs on behalf of numerous major insurance companies. 99% of repairs completed on the first visit due to carrying a comprehensive van stock of spare parts. Please note that I will not repair an appliance if anyone.

washingmachinerepairswolverhampton.co.uk washingmachinerepairswolverhampton.co.uk

Castlecroft Domestic Services - Local Domestic Appliance Repairs

Castlecroft Domestic Services Ltd. Fast Response Local Domestic Appliance Repair Experts. Sales and Guaranteed Repairs. Please Note: We do not supply spare parts for DIY or Trade Repairs. Phone Lines open 8am-8pm 7 Days. Fast Response Electric Cooker Repairs, Electric Oven Repairs, Electric Hob Repairs, Washing Machine Repairs and Domestic Appliance Repairs in Wolverhampton and surrounding areas. In February 2014 we celebrated trading for 25 years. Our Services and Products. Sales of new appliances, s.

washingmachinerepairsworthing.co.uk washingmachinerepairsworthing.co.uk

Washing Machine Repairs Worthing - CRB Checked Engineers

Washing Machine Repairs Worthing. We repair most appliances so give us a call! December 15, 2010 9:54 am. Obviously if you are able to afford the likes of Bosch, Neff, Miele etc then you can expect a decent life-span and hopefully fewer or no problems, but most of the public who buy standard machines from the superstores or on-line expect to be replacing them within a couple of years and seem happy to do this. Obviously not all faults will be economical to repair and we will of course advise you of this ...

washingmachinerepairsydney.net washingmachinerepairsydney.net

Washing Machine Repair Sydney $88 Free Estimates Online

Washing Machine Repair Sydney $88 Free Estimates Online. Skip to primary content. Skip to secondary content. Our $88 Parts Web Special Offer available for areas Lower Norh Shore – Eastern Suburbs – Bankstown – Inner West – St George Sutherland. Our offer of $88.00 includes all work and the service call involved in the repair of your washing machine in your home during normal business hours, Monday - Friday. You pay extra for parts if needed. Call Mark on 0412 285 205. Washing Machine Repairs Sydney.

washingmachinerepairsyeovil.com washingmachinerepairsyeovil.com

Yeovil Washing Machine Repairs

Yeovil Washing Machine Repairs. 2 Welbeck Road -. Washing Machine Rentals 5 p/w. Short term contracts minimum 4 months. If you are looking for a first-class service, you have come to the right place! We aim to be friendly and approachable. We are here to serve you and answer any questions you may have. Call us today: 07940912543. We put our customers first. We listen to you and help you find what is the best solution to repair your. Refurbished Washing Machines From 75.00. Delivery Locally e.g Yeovil.

washingmachinerepairtaunton.co.uk washingmachinerepairtaunton.co.uk

Washing Machine Repair Taunton | Taunton Washing Machine Repair

Washing Machine Repair Taunton. We guarantee that at Washing Machine Repair Taunton. You will find the best quality emergency Washing Machine Repair service in the region, based on the vast experience and thorough training of our expert Washing Machine Repair engineers. They always put the customer first, and promise to be with you quickly in an emergency - on the very same day wherever possible. As well as the very best washer dryer repairs. Service and no hidden charges. Washing Machine Repair Taunton.

washingmachinerepairtorbay.co.uk washingmachinerepairtorbay.co.uk

Washing Machine Repair Torbay | Torbay Washing Machine Repair

Washing Machine Repair in Torbay. If you are looking for the best washing machine repairs in Torbay, give Washing Machine Repair Torbay. A call today. For years we have been offering local customers same day service at the lowest prices around and would be delighted to assist you with your washing machine repairs. Our engineers are the best in the business and will get your appliance up and running before you know it. Here at Washing Machine Repair Torbay. Bosch, Beko, Indesit Washing Machine Repairs.

washingmachinerepairtowerhamlets.co.uk washingmachinerepairtowerhamlets.co.uk

Washing Machine Repair Tower Hamlets | Tower Hamlets Washing Machine Repair

Washing Machine Repair Tower Hamlets. Washing machines are one of our most used appliances. They have a hard life and are often prone to developing the odd fault, perhaps a part needs replacing or there is a leak.whatever the issue with your washing machine, you will want to be sure the company you contact is reputable, reliable and experienced. That where Washing Machine Repairs Tower Hamlets. Not only are our washer dryer repairs. To put the icing on the cake, our prices are highly competitive. We ...

washingmachinerepairtunbridgewells.co.uk washingmachinerepairtunbridgewells.co.uk

Washing Machine Repair Tunbridge Wells | Tunbridge Wells Washing Machine Repair

Washing Machine Repair Tunbridge Wells. Washing Machine Repair Tunbridge Wells. Washing Machine Repair Tunbridge Wells. Has built up a team full of highly qualified and experienced engineers, all of whom are more than capable of performing highly successful and efficient Washing Machine Repair. This has led to us becoming the leading appliance repairs company in the area, with countless satisfied customers ready to recommend us to their family and friends. Our expert washer/dryer repairs. Security Box (D...

washingmachinerepairwakefield.co.uk washingmachinerepairwakefield.co.uk

Washing Machine Repair Wakefield | Wakefield Washing Machine Repair

Washing Machine Repair Wakefield. Here at Washing Machine Repairs Wakefield. Our team of expert engineers have been undertaking successful and effective washing machine repairs throughout Wakefield for a number of years. During that time, our experience, knowledge and expertise has grown and Washing Machine Repairs Wakefield have become the premier company for washing machine repairs in Wakefield and the surrounding area. Washing Machine Repairs Wakefield are the only company in Wakefield to call. Washin...