WESTERNCAPEDIRECTORY.CO.ZA
Bellville Business Directory, Cape Town, South AfricaBellville Online serves to provide a comprehensive listing of businesses and services in the area and surrounds
http://westerncapedirectory.co.za/
Bellville Online serves to provide a comprehensive listing of businesses and services in the area and surrounds
http://westerncapedirectory.co.za/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
0.8 seconds
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
0
SITE IP
197.221.14.96
LOAD TIME
0.793 sec
SCORE
6.2
Bellville Business Directory, Cape Town, South Africa | westerncapedirectory.co.za Reviews
https://westerncapedirectory.co.za
Bellville Online serves to provide a comprehensive listing of businesses and services in the area and surrounds
westerncapedeafcycling.blogspot.com
Western Cape Deaf Cycling Association
Western Cape Deaf Cycling Association. The Secretary, PO Box 5293, WORCESTER 6850 . deafcycling@telkomsa.net. Tuesday, April 27, 2010. Paul Kloppers have completed the IRON MAN competition recently! Well done Paul. Not anyones cup of tea. From all of us @ WCDCA. Western Cape Deaf Cycling. Saturday, March 20, 2010. Deaf Cyclists invited to ride Charity Run. By Tamara on March 6, 2010. Everyone on the 2010 Cycle Challenge gets the opportunity to lead the team whether or not they are strong or weaker riders...
WCDSF - Home
Welcome to the WCDSF website. This is the official Western Cape Deaf Sports Federation website. The key objectives of the WCDSF are to encourage and promote every Deaf Sport Member with a hearing impairing to participate and enjoy sport. By visiting this website, you are already supporting the WCDSF, better is to join or sponsor one of the many activities and events that WCDSF hosts and organises on a regular basis. 2011 Year End Function Photos.
westerncapedental.com - This domain may be for sale!
Westerncapedental.com has been informing visitors about topics such as Dental Services, Implantes Dental and Dentures Dental. Join thousands of satisfied visitors who discovered Free Dental, Dental Emergency Hospital and Work from Home Jobs Cape Town. This domain may be for sale!
Western Cape Diamonds - Offering Quality to the Diamond and Jewellery World
Western Cape Diamonds is one of the europe's premier sources of rough and cut diamonds. We offer the most extensive inventory at the most competitive prices within the diamond world. Our inventory covers some of the rarest stones in the market place, from rare colours to rare cuts. We at Western Cape Diamonds offer extremely competitive services to both the public and trade. Please visit our services. Page for further information. 2006 Western Cape Diamonds. KÃ b billige all star converse. Nike air max 90.
Western Cape Diamonds - Offering Quality to the Diamond and Jewellery World
Western Cape Diamonds is one of the europe's premier sources of rough and cut diamonds. We offer the most extensive inventory at the most competitive prices within the diamond world. Our inventory covers some of the rarest stones in the market place, from rare colours to rare cuts. We at Western Cape Diamonds offer extremely competitive services to both the public and trade. Please visit our services. Page for further information. 2006 Western Cape Diamonds. KÃ b billige all star converse. Nike air max 90.
Bellville Business Directory, Cape Town, South Africa
Visit our other directories:.
Soon to be the new home of: www.westerncapedotpw.com
Soon to be the new home of.
Western Cape Eco Tours Weipa | Sunset cruises, daily river tours and customised charters
Western Cape Eco Tours, Weipa, Cape York. 10:00 AM - 12:00 PM. 12:00 PM - 02:00 PM. 02:00 PM - 04:00 PM. 04:00 PM - 06:00 PM. 06:00 PM - 08:00 PM. British Indian Ocean Territory. Congo, The Democratic Republic of the. Heard Island and McDonald Islands. Holy See (Vatican City State). Iran, Islamic Republic of. Korea, Democratic People's Republic of. Korea, Republic of. Lao People's Democratic Republic. Macedonia, The Former Yugoslav Republic of. Micronesia, Federated States of. Saint Kitts and Nevis.
westerncapeemergencyservices.com
FRONT PAGE - www.westerncapeemergencyservices.com
Western Cape Aerial Emergency Services t/a Western Cape Emergency Services. The Western Cape Emergency Services can provide you with a number of services such as:. Threat, Risk, Hazard and Vulnerability Assessment. Fire Prevention and Rational Design for drawings. Safety and Emergency Planning. Occupational Health and Safety. Disaster and Emergency Management. Bio-Green non-Toxic fire retardant Foam. For more information or assistance contact us:. E-mail: info@westerncapeemergencyservices.co.za.
Home - Epic Properties
If you are the prudent buyer in pursuit of a specific type of agricultural holding, with a need for a streamlined and effective property overview, and you want to benefit from our professional approach to property marketing. As experienced property experts with a modern style we will adapt to you specific needs and preferences. Western cape winelands farm sales. In service of the buyer.
Soon to be the new home of: www.westerncapefarms.com
Soon to be the new home of.