
whileloop.wordpress.com
whileloop | while(true) { blog.post(profound.musings, random.discoveries) ; }while(true) { blog.post(profound.musings, random.discoveries) ; } (by Cameron)
http://whileloop.wordpress.com/
while(true) { blog.post(profound.musings, random.discoveries) ; } (by Cameron)
http://whileloop.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
2.1 seconds
16x16
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
10
SITE IP
192.0.78.12
LOAD TIME
2.141 sec
SCORE
6.2
whileloop | while(true) { blog.post(profound.musings, random.discoveries) ; } | whileloop.wordpress.com Reviews
https://whileloop.wordpress.com
while(true) { blog.post(profound.musings, random.discoveries) ; } (by Cameron)
coding/development links | whileloop
https://whileloop.wordpress.com/index-of-useful-links
While(true) { blog.post(profound.musings, random.discoveries) ; }. Here’s a list of useful coding/development links all collated in one place for easy reference. If there are others you think I should add in, message me or put them in the comments, and I’ll add them in. 8211; Windows, Apache, MySQL, PHP. All installed in one easy bundle. WAMP Server does all the work for you with minimal configuration and hassle. Open source, and free. Download here. And many others too; as well as a forum. Is just what ...
NO TEXTING! Alamo Drafthouse fights back (NSFW) | whileloop
https://whileloop.wordpress.com/2011/07/09/no-texting-alamo-drafthouse-fights-back-nsfw
While(true) { blog.post(profound.musings, random.discoveries) ; }. I made it into Google …first impressions. Been biting my tongue, now I vent →. Alamo Drafthouse fights back (NSFW). Saturday, July 9th, 2011. Warning: this is the uncensored version (ie NSFW) –. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Notify me of new comments via email. John McAf...
My birthday is coming (I have a cunning plan!!) | whileloop
https://whileloop.wordpress.com/2011/08/11/my-birthday-is-coming-i-have-a-cunning-plan
While(true) { blog.post(profound.musings, random.discoveries) ; }. Been biting my tongue, now I vent. RIP Steve Jobs →. My birthday is coming (I have a cunning plan! Thursday, August 11th, 2011. Next week is my birthday (Friday 19th). I’m not saying that to get attention, but to utilise that attention. We live in a Social Media age, and everyone uses that media to wish ‘Happy Birthday’ to all those they haven’t spoken to in years. I have a cunning plan:. To support their African Appeal. I'm a final year ...
tutorial posts | whileloop
https://whileloop.wordpress.com/useful-code
While(true) { blog.post(profound.musings, random.discoveries) ; }. Some written by me, some sourced from elsewhere (referenced, of course! CSS, PHP, Java, C#, CPP, HTML, bits of everything really. A work in progress, as I post them to the blog, I will index them here too. I have quite a few more already planned, I just need to actualy get them written and posted. HTML special character reference table. 8211; just like it says. 8211; define CSS attributes dependent on browser being used. Triggers to contr...
Been biting my tongue, now I vent | whileloop
https://whileloop.wordpress.com/2011/08/03/been-biting-my-tongue-now-i-vent
While(true) { blog.post(profound.musings, random.discoveries) ; }. Alamo Drafthouse fights back (NSFW). My birthday is coming (I have a cunning plan! Been biting my tongue, now I vent. Wednesday, August 3rd, 2011. I’ve been biting my tongue for a while, but I really need to vent finally. This is not about world hunger, or curing AIDS, or anything earth-shattering, but in its own small way it could be world-changing. The issues with this:. Traffic Wave on Wikipedia. By stopping suddenly to give way, the d...
TOTAL PAGES IN THIS WEBSITE
6
sqwi.sh | statistics
http://sqwi.sh/stats.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. Get usage statistics for your sqwi.sh. 2009 - sqwi.sh.
sqwi.sh | premiere account
http://www.sqwi.sh/premiere.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. Why a Premiere Account? A Premiere Account provides you with another level of service. I will send daily, weekly or monthly statistics of your url usages to your email box. This can be in a variety of formats (.csv, .xls, .pdf), and provides you with the ability to develop in-depth profiles of your visitors, easily and effectively. Paid annually in advance.
sqwi.sh | why??
http://sqwi.sh/why.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. The about it all page. Why did I do it? Ah, yes, that old chestnut; why did you bother doing it, especially since there are already other sites providing the same service? They aren't providing the same service! If you do have a request for a specific functionality or data/statistical provision, please don't hesitate to contact me. The buttons I use around the s...
sqwi.sh | API
http://api.sqwi.sh/requestapikey.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. 2009 - sqwi.sh.
sqwi.sh | terms of use
http://sqwi.sh/tandc.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. Is a free service to make posting long urls simple and clean. Using a sqwi.sh. D url for spamming or illegal purposes is forbidden and any such use will result in the sqwi.sh. Anyway, it's free, so why bother stealing or abusing it (or complaining), just use the site. Please report issues to me here. And I will remove the link if appropriate. 2009 - sqwi.sh.
sqwi.sh | donate
http://sqwi.sh/donate.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. I want to first thank you for even making it to this page. It shows that you are willing to consider donating to support my efforts here. Why ask for donations? D urls for free for any purpose - commercial or not - excluding those in the terms and conditions. Such as spam or illegal activities). From this, all I would ask is that you consider passing a few dolla...
sqwi.sh | size does matter
http://www.sqwi.sh/index.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. Welcome to sqwi.sh. Max 1024 characters including "http:/ " or "https:/ " ). A custom url can provide you with an effective marketing tool eg www.sqwi.sh/nzmusic. Is short, but also tells the user what it is for. A password restricts access to the statistics for your sqwi.sh. This is not compulsory, and does not restrict use of the sqwi.sh. Service is provided a...
sqwi.sh | API
http://api.sqwi.sh/index.php
To your toolbar. Just drag-and-drop the link onto your bookmarks bar. Then sqwi.sh any page you're visiting! The sqwi.sh API. API keys are here. API is here and available now. It is still in BETA, but I've been hammering it for a while now, so it should be pretty solid. I've had a few 3rd-party apps pointing at it too, and they seem happy. The basic structure of the endpoint is:. Http:/ api.sqwi.sh/{method}.{format}? At this stage there are three methods:. Mandatory] - the URL to be shortened. Http:/ api...
TOTAL LINKS TO THIS WEBSITE
10
While Lola Naps
Adventures of Lola, life, and faith. Wednesday, February 10, 2016. If you love Jesus, you have to move to Africa. My husband and I recently announced that at the end of the school year, our family will be moving from Peoria, IL to Dallas, TX. The way that this job all came about was seriously incredible. The entire process I felt the Lord's provision and peace. I wanted to share our story, how this all came to place, and my thoughts on the possibility of moving these last few months. He's basically a gen...
whilelookingoutovermountpleasant.blogspot.com
While looking out over Mount Pleasant
While looking out over Mount Pleasant. Sunday, October 18, 2009. Am I a six question deep friend? A friend of mine recently described Washington, DC as a six question deep town. Most of America is a one question town when it comes to current events. "What do you think of the healthcare plan? Boy, I don’t know, but we got to do something." In DC you better be prepared to answer about five follow up questions on any generic answer you give on current events. How was your day? Can I help in any way? I reali...
WhileLoop Ltd
404 - PAGE NOT FOUND
ERROR 404 - PAGE NOT FOUND. Why am I seeing this page? 404 means the file is not found. If you have already uploaded the file then the name may be misspelled or it is in a different folder. You may get a 404 error for images because you have Hot Link Protection turned on and the domain is not on the list of authorized domains. Are you using WordPress? See the Section on 404 errors after clicking a link in WordPress. How to find the correct spelling and folder. Missing or Broken Files. Notice that the CaSe.
Find the best domain names to register
Register a Domain Name Who Owns This Domain? The domain name registration process for your businesses web site begins here. Register a great domain name with Verio from only $9.95 and receive a free 3 page website and email account. 1 Find Your Domain Name. 2 Choose Your Extensions. Enter up to 5 domain names. Couk ($38 for 2 years). Create the site you want with Verio hosting plan options. Verio is your strategic partner for top-tier hosting for complex websites and dedicated hosting.
whileloop | while(true) { blog.post(profound.musings, random.discoveries) ; }
While(true) { blog.post(profound.musings, random.discoveries) ; }. I’ve moved blogs. Friday, August 10th, 2012. I’m not posting to this blog anymore. I’ll still be monitoring comments here, so I’ll be able to still provide sporadic responses and help. For now, you can follow me on my main blog: camerontwigden.tumblr.com. Thursday, October 6th, 2011. My birthday is coming (I have a cunning plan! Thursday, August 11th, 2011. I have a cunning plan:. Please feel free to wish me a Happy Birthday on twitter.
Whileloops | Random Programming Stuff
Django On a Raspberry Pi. April 6, 2015. April 8, 2015. I am setting up my Raspberry PI. To run as Django server and I would like to share the steps right here both to save someone else attempting to do this some time as well as get any feedback in case there are different/better ways to do any of this. Reconfigure the Keyboard Mapping. After Raspbian wheezy install, in my case I noticed when in vim I couldn’t type things like #, , and @ so I had to do the following:. Sudo easy install pip. The first tim...
While Loops
Web agency con sede a Minerbio in provincia di Bologna, specializzata nella realizzazione di siti web e nella creazione di applicativi web-based, portali ecommerce e piattaforme online. Offriamo servizi SEO per il posizionamento sui motori di ricerca e di Social web Marketing, inoltre grazie ad una rete di partners realizziamo loghi, grafiche pubblicitarie, packaging, biglietti da visita, brochures, depliant e fotografia. Curiamo e gestiamo i tuoi account dei vari Social Network, in modo da creare una re...
whilem-meieli-ch-f.skyrock.com
Blog de WHILEM-MEIELI-CH-F - WHILEM-MEIELI-CH-F - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Mise à jour :. Donne Moi Le Temps (Jenifer and Quentin Mosimann). Abonne-toi à mon blog! Notre mariage le 20 juin 1998. Nous nous sommes mariés à la mairie le matin et l'après-midi à l'Eglise. Mon cousin, prêtre, qui a marié mes parents et qui nous a baptisés mon frère et moi, nous marient Gérard et moi. Il fait très beau ce jour-là et je suis persuadée dans ma petite tête que nous aurons un enfant ensemble. Super heureuse. Posté le lundi 24 mars 2008 10:02.
whilemaandpawsawaypetservices.com
While Ma and Paws Away Pet Services | Dog Walking | Vacation Care | Pet Taxi
While Ma and Paws Away Pet Services. Dog Walking Vacation Care Pet Taxi. South Bend, IN 46680. Why Hire a Professional Sitter? Policies and Service Terms. Why Hire a Professional Sitter? Life is busy, without a doubt, let my compassionate, honest, and dependable services. Give you one less thing to worry about! Serving South Bend, Mishawaka, Osceola, and Granger. Blog at WordPress.com.
whilemakingmoneyonline.blogspot.com
Making Money Online
Things to Avoid While Making Money Online. If you are one of the many people looking for ways to make money online, then you need a few things that distract you and can not allow you to reach your goals can be avoided. There are legitimate ways to earn money online, but there is no shortcut to success on the Internet as well. Subscribe to: Posts (Atom). Developing Your Business Presence. Start an Online Business. How To Make An Online. Ethereal template. Powered by Blogger.
SOCIAL ENGAGEMENT