crochetsavvy.com
Crochet Savvy Magazine — Trendy...Modern...Fashionable...Trendy...Modern...Fashionable...
http://www.crochetsavvy.com/
Trendy...Modern...Fashionable...
http://www.crochetsavvy.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Sunday
LOAD TIME
1 seconds
16x16
32x32
64x64
LaTonya Malinconico
8800 S.●●●●●●●od #207
Ho●●on , Texas, 77031
UNITED STATES
View this contact
LaTonya Malinconico
8800 S.●●●●●●●od #207
Ho●●on , Texas, 77031
UNITED STATES
View this contact
LaTonya Malinconico
8800 S.●●●●●●●od #207
Ho●●on , Texas, 77031
UNITED STATES
View this contact
BUY YOUR DOMAIN
12
YEARS
2
MONTHS
22
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
38
SITE IP
50.62.254.1
LOAD TIME
1.01 sec
SCORE
6.2
Crochet Savvy Magazine — Trendy...Modern...Fashionable... | crochetsavvy.com Reviews
https://crochetsavvy.com
Trendy...Modern...Fashionable...
crochetsavvy.com
Freebies
http://crochetsavvy.com/freebies
FREE – PDF- eGuides from Craftsy.com! Final Crochet Savvy Magazine issue scheduled for January 2016. The Mini Summer Mag Issue is now available! Looking to hire new Positions on Staff. Crochet Savvy version francais! FREE TRENDING CROCHET PATTERNS! Check out our Pretty Pinterest Pins! Follow Crochet Savvy Magazine on Pinterest. Follow knitFABULOUS on Pinterest. X000B7; Log in.
Magazine Crochet Savvy, version française – The Official Crochet Savvy Magazine in French
http://crochetsavvy.com/francais
Magazine Crochet Savvy, version française. À la version française du Magazine Crochet Savvy! Le crochet pour une bonne CAUSE. Nicole Harris: Sensibilise le public à la réalité de l’autisme avec ses designs au crochet Par Aldonia Secession. Comment avez-vous découvert le magazine Crochet Savvy? R: J’ai découvert le magazine lorsque j’ai vu un article à propos d’une autre artiste dont je connaissais les créations. Q: Quand avez-vous appris le … [Continuer.]. Q: Shanon Fouquet, selon votre site web, c’est e...
Pattern: Sherbet Cowl
http://crochetsavvy.com/2014/11/pattern-sherbet-cowl
November 29, 2014. 24 [61 cm] circumference of body; 8 (20.3 cm) tall. Red Heart Boutique Unforgettable. 100% acrylic; 280 yds [256m], 3.5 oz [100 g];): #3955 Winery, 1 ball. Size US H/8 (5 mm) or size to obtain correct gauge. 1 rep wide = 1.2 (3cm) in pattern stitch. Gauge is not crucial, but it will affect the finished size and yarn requirements. Front Post Double Crochet. Back Post Double Crochet. Holding back last loop of each dc on hook, 2 dc in next st, yo, pull through all loops on hook. Ch 3, *(2...
Winter style
http://crochetsavvy.com/2015/01/winter-style
January 30, 2015. Featuring quote canvas wall art. I love the arts, music and movies. I am a big nerd. Marvel comics.yes! I love all of the above. Furthermore, I enjoy a great plot, a good mystery to solve and great company of true friends. When I create art, whether through crafting, painting or design, I am happy. Creating brings me joy. And I hope that one day I can pass on these skills to my children. For more about me, visit my blog knitFABulous at www.knitfabulous.com. Leave a Reply Cancel reply.
Magazine Issues
http://crochetsavvy.com/magazine-issues
Our Winter 2015-16 issue is now available! Final Crochet Savvy Magazine issue scheduled for January 2016. The Mini Summer Mag Issue is now available! Looking to hire new Positions on Staff. Crochet Savvy version francais! FREE TRENDING CROCHET PATTERNS! Check out our Pretty Pinterest Pins! Follow Crochet Savvy Magazine on Pinterest. Follow knitFABULOUS on Pinterest. X000B7; Log in.
TOTAL PAGES IN THIS WEBSITE
19
FurlsCrochet | Candy Shop Crochet Hooks: Choose from Sizes F, G, H and I
http://furlscrochet.com/products/candy-shop-crochet-hooks-sizes-f-i
Masterfully hand crafted yarn bowls and 12 hook stands are now available for our beautiful Candy Shop hooks! Made out of professional grade polyresin, sculpted into beautiful taffy swirls, and finished with bright bubblegum pink paint, these pieces are the most jaw-dropping, eye-catching, desire-inducing Candy Shop accessories out there! Complete your Candy Set and get them all. Free shipping through 7/25/16 to USA and Canada with the code IWantBubblegum! Straighter rows and more even stitches are natura...
FurlsCrochet | Testimonials and Reviews
http://furlscrochet.com/pages/testimonials
What Crochet Designers Say About Furls Hooks. I've crocheted for hour after hour with my Furls and never suffered the hand fatigue that used to slow me down. Tamara uses a 5.5mm Cocobolo hook. Crochet Designer and Founder of Moogly. This is the most fantastic hook I own. I highly recommend Furls to anyone who is passionate about crochet. This hook is a work of art! Lianka uses all 4 Candy Shop Hooks and a Tulipwood Alpha Series Hook. Crochet Designer and Founder of Bonita Patterns. So, me and my tiny han...
FurlsCrochet | Testimonials and Reviews
http://www.furlsfiberarts.com/pages/testimonials
What Crochet Designers Say About Furls Hooks. I've crocheted for hour after hour with my Furls and never suffered the hand fatigue that used to slow me down. Tamara uses a 5.5mm Cocobolo hook. Crochet Designer and Founder of Moogly. This is the most fantastic hook I own. I highly recommend Furls to anyone who is passionate about crochet. This hook is a work of art! Lianka uses all 4 Candy Shop Hooks and a Tulipwood Alpha Series Hook. Crochet Designer and Founder of Bonita Patterns. So, me and my tiny han...
Reviews
http://knitfabulous.org/category/reviews
You are here: Home. Filofax Domino A5 size Hot Pink Patent color – A Review. November 13, 2015. By Keturah Ariel iknitFAB Malinconico. I absolutely LOVE this planner! I was trying to see if this size would be too big, but it is perfect. Even good enough for my bag- which is always tote size. Traveling with the A5 I know that the majority of people in the planner community feel that this is not travel friendly. I […]. Knit to Flatter- a book review. September 10, 2014. By Keturah Ariel iknitFAB Malinconico.
Marriage/Relationships
http://knitfabulous.org/category/marriagerelationships
You are here: Home. Six Habits of Happily Married Couples. November 24, 2010. By Keturah Ariel iknitFAB Malinconico. Six Habits of Happily Married Couples by Rabbi Dov Heller, M.A. Success in marriage hinges on consistent performance of six key habits. HABIT #1 – GIVE EACH OTHER PLEASURE Happily married couples are committed to the goal of giving each other pleasure. You must stay focused on the ultimate goal — which is to give […]. Cervical Cancer, Relationships and Divorce. June 13, 2010. May 1, 2010.
Family
http://knitfabulous.org/category/family
You are here: Home. Free A5- Daily Living Planner Insert. January 24, 2016. By Keturah Ariel iknitFAB Malinconico. This is my favorite planner insert from my new “Live Life and Be Organized” branded planner inserts. It is a Daily insert but with the added benefit of being a daily productivity insert as well. After searching hi and low for something that I could track a tons of things on without flipping […]. 10 Reasons Why Handheld Devices Should Be Banned for Children Under the Age of 12. March 10, 2014.
Keturah Ariel “iknitFAB” Malinconico
http://knitfabulous.org/author/keturahariel
You are here: Home. Archives for Keturah Ariel iknitFAB Malinconico. Free A5- Daily Living Planner Insert. January 24, 2016. By Keturah Ariel iknitFAB Malinconico. This is my favorite planner insert from my new “Live Life and Be Organized” branded planner inserts. It is a Daily insert but with the added benefit of being a daily productivity insert as well. After searching hi and low for something that I could track a tons of things on without flipping […]. December 15, 2015. December 15, 2015. Keturah Ar...
Freebies
http://knitfabulous.org/freebies
You are here: Home. FREE – PDF- eGuides from Craftsy.com! FIND ME ON…. I create fabulous things. My brain is filled with color. I am custom, I am not bound by boxes. "Everything is bigger on the inside". I'm me. More about Keturah. Free A5- Daily Living Planner Insert. Captain America: Civil War Trailer ALL EASTER EGGS. X-MEN: APOCALYPSE Official Trailer! Free A5 Planner Inserts – Notes Page & Password List. Filofax Domino A5 size Hot Pink Patent color – A Review. Your cart is empty. X000B7; Log in.
Shop Patterns
http://knitfabulous.org/store
You are here: Home. Welcome to my Pattern Store! All patterns can be purchased for download via PayPal. Once purchased, you will receive an email update with a link to your pattern in PDF file. If you have any tech problems or concerns, please drop us a line on our contact page. Thanks for supporting knitFABulous! Click on the photos to take you to the product description pages. Zoe Vest – Crochet Pattern. Alexis Moss Stitch Convertible Cowl – Knit and crochet Pattern. FIND ME ON…. Your cart is empty.
fashion
http://knitfabulous.org/category/fashion
You are here: Home. March 17, 2013. By Keturah Ariel iknitFAB Malinconico. Casual & chic by aline29 featuring mango sandals Keturah Ariel “iknitFAB” MalinconicoIn 2010, K. Malinconico started her own company, “Bohemian Design Solutions”, which involves self publishing, graphics, websites and photography. A former hip hop artist, K. Malinconico loves to write, knit, crochet, cook and sew. She is a wife, a mom and a leader in […]. March 16, 2013. By Keturah Ariel iknitFAB Malinconico. October 15, 2012.
TOTAL LINKS TO THIS WEBSITE
38
CrochetSal's
Monday, September 05, 2016. I love going to Value Village. Yes, you DO have to watch prices, because to be honest, the people doing the pricing don't always realize that you can buy the new product for not much more.and it will be pretty much guaranteed smoke-free. But sometimes, I do find treasures. I usually browse (slowwwwly) through the sci-fi and fantasy (and vintage) book section, then the glass and the bagged up "etc." stuff. Silver. It was handy. The before and after:. I want to try other colours...
crochetsale
Here is my blog that I created for selling my handmade items. I started this blog as a hobby. Email me or leave a comment if you are interested in buying. Returns will be accepted only if it is in original condition and buyers have to pay for return shipping. Once you pay me, I will ship the item within 3 working days. Payment through PAYPAL only. Tuesday, May 1, 2012. Price : $3.00. Shipping within USA : $1. Outside USA : depends on the location. Perfect to embellish your crafts! Shipping within USA : $1.
crochetsamurai.livejournal.com
crochetsamurai's Journal
20 most recent entries. I'm not sure who created this syndicated feed from my typepad blog, but thank you, and here's the link. :). Http:/ syndicated.livejournal.com/pepperberry cr. Working on a custom slug. Citrus Bag Pattern is finished. The Citrus Bag pattern is finished and up for sale over on etsy. If you're interested. A fun pattern to make and a really sturdy bag that I'm getting a lot of use out of. Terrariums at Naughty Secretary Club. Even better, there's a great print by Gennine. So, the ottom...
Crochet Saved My Life | The Mental and Physical Health Benefits of Crochet
Darr; Skip to Main Content. Crochet Saved My Life. The Mental and Physical Health Benefits of Crochet. Press, News and Reviews. The Women Who Hook to Heal. Crochet Saved My Life. The Mental and Physical Benefits of Crochet. Join the Crochet Saved My Life Ravelry group. A safe space to share your own story of crafting to heal and to connect with others in this community. There are three different spaces to follow this book and author on Facebook:. Crochet Saved My Life. The author has her own fan page.
crochetsavedmylife.kathrynvercillo.com
Crochet Saved My Life | The Mental and Physical Health Benefits of Crochet
Darr; Skip to Main Content. Crochet Saved My Life. The Mental and Physical Health Benefits of Crochet. Press, News and Reviews. The Women Who Hook to Heal. Crochet Saved My Life. The Mental and Physical Benefits of Crochet. Join the Crochet Saved My Life Ravelry group. A safe space to share your own story of crafting to heal and to connect with others in this community. There are three different spaces to follow this book and author on Facebook:. Crochet Saved My Life. The author has her own fan page.
Crochet Savvy Magazine — Trendy...Modern...Fashionable...
Welcome to Savviness…. Thanks for visiting us! Crochet Savvy Magazine is a free online digital crochet magazine that featured designers, their life stories as well as crochet industry news and updates. The magazine was journalistic in nature and ran from 2012-2016. All of our magazine issues are still online and available for reading. It was a joy to work on such an awesome project. Thanks for your support of Crochet Savvy Magazine. Enjoy the site! From the Archives…. November 29, 2014. November 13, 2014.
Blog - Crochets By Lisa
Custom crochet designs for all ages! Enter your email address. Crochet Patterns &Designers. Yarn & Hook Reviews. Spiral Shawl Pattern Review. March 26, 2015. I love a shawl. When I saw this Spiral Shawl during a Design Wars Challenge. I knew I had to try it! If you haven’t checked out Design Wars, please do so, it’s a great challenge,featuring designers and yarn, bringing you great new patterns, in a fun competition. That is this pattern. If you are interested in purchasing this awesome pattern you can f...
Crochet School is a place to learn how to crochet
Crochets corner
Sunday, June 26, 2011. Hellow all, , i finally crochet again, , ,. Aslinya disini nih disini nih. Not sooo me, ,. Ini tugas dari crochet design. Yang harus punya lengan, dan shaping, jadi beginilah, ,. Sunday, December 19, 2010. Gelang ini salah satu project tantangan untuk diriku sendiri, , selengkapnya bisa dilihat disini :. Monday, November 1, 2010. Ke jogja lagi, , ke kampus lagi, , bernostalgia pada jatidiriku yang dulu.hihihi, ,. X= urutan baris pada shawl. F(x) = jumlah dc pada tiap x. F(x) = ax b.
Blog de crochetsdart971 - crochets passion - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Plus d'actions ▼. S'abonner à mon blog. Création : 01/09/2008 à 18:03. Mise à jour : 14/08/2010 à 08:06. Confection d'ouvrage aux crochets d'art: Napperon, Barbie de décoration, Vètements de bébé, Broche. Sac pour parrain et maraine. Ce sac avec écriture de broderie a été réalisé par moi mème pour un baptème. lécriture dit : ( parrain, guide moi tout au long de ma vie chrétienne). Ou poster avec :. Posté le samedi 14 août 2010 08:04. Ou poster avec :. N'oubli...
Bio Twine - Tomatenhakenwikkelbedrijf van den Wijngaart B.V.
Tomatenhakenwikkelbedrijf van den Wijngaart. Crochet à tomates. Ce site montre comment utiliser le crochet à fil élevé que nous avons conçu, également connu sous le nom de crochet à tomate. Crochet à fil élevé avec système J.S. Crochet à tomates. Grande consommation emballages crochets a tomates. Regarder la vidéo d'instruction. Regardez notre vidéo d'instruction qui montre comment utiliser notre produit. Le crochet à tomate standard est enroulé de ficelle Lankhorst synthé...Joh Vos Cappelle BV.
SOCIAL ENGAGEMENT