Driving Lessons Cheltenham, Driving Schools Cheltenham offers first class Manual and Automatic Driving Lessons in Cheltenham with fully qualified Driving Instructors Cheltenham. Pass Driving Test Cheltenham
http://www.drivinglessonscheltenham.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
0.5 seconds
16x16
David Hart
545 Fox●●●●●●●es Road
Bir●●●ham , B28 8RL
GB
View this contact
One.com
Host Master
Kalveb●●●●●●gge 24
Cope●●●●en V , 1560
DK
View this contact
One.com
Host Master
Kalveb●●●●●●gge 24
Cope●●●●en V , 1560
DK
View this contact
BUY YOUR DOMAIN
Ascio Technologies, Inc. Danmark - Filial af Ascio technologies, Inc. USA (R76-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
4
SSL
EXTERNAL LINKS
2
SITE IP
46.30.213.92
LOAD TIME
0.508 sec
SCORE
6.2
Driving Lessons Cheltenham | Andy1st Driving School | drivinglessonscheltenham.org Reviews
https://drivinglessonscheltenham.org
Driving Lessons Cheltenham, Driving Schools Cheltenham offers first class Manual and Automatic Driving Lessons in Cheltenham with fully qualified Driving Instructors Cheltenham. Pass Driving Test Cheltenham
drivinglessonscheltenham.org
Driving Lessons Cheltenham - Prices
http://www.drivinglessonscheltenham.org/driving-lessons-prices.html
Pass Driving Test First Time. Driving Lessons Cheltenham : Prices. Driving Lessons Cheltenham, very competitive prices and an excellent service. All fully qualified driving instructors unlike other driving schools in Cheltenham. First 3 x 1 Hour Driving Lessons. Block Booking 10 Driving Lessons. 1 Hour Refresher Driving Lesson. 20 Hours Intensive Driving Course. 30 Hours Intensive Driving Course. 40 Hours Intensive Driving Course. Andy1st Driving School Cheltenham. Take Driving Lessons in Cheltenham.
Driving Lessons in Cheltenham - Our Courses
http://www.drivinglessonscheltenham.org/driving-lessons-cheltenham.html
Pass Driving Test First Time. We offer a wide range of Courses at our Driving School in Cheltenham. Please check below to see if we have the service that you require. Weekly Driving Lessons in Cheltenham. You can take your driving lessons in Cheltenham on a weekly basis if you like. You can decide as to how long you would like your driving lessons to last. You can do 60, 90, 120 minute driving lessons, or more if you prefer. Pass your Driving Test fast. All one to one lessons. Various Packages to suit.
Driving Lessons Cheltenham | Andy1st Driving School
http://www.drivinglessonscheltenham.org/index.html
Pass Driving Test First Time. Excellent price for beginners. Courses to suit everyone. High Grade Driving Instructors in Cheltenham. Learn to Drive with Andy1st. Make the perfect choice. Pass Test 1st Time with our Driving School. Manual and Automatic cars available. Prices. Latest, modern dual controlled cars. Clean and tidy cars. Relax and enjoy your lessons. Services. Driving Lessons in Cheltenham : Contact Details. Or like to book a lessons then. Contact Andy1st. Manual Driving Lessons Cheltenham.
Driving Lessons Cheltenham - About Our Driving School
http://www.drivinglessonscheltenham.org/about.html
Pass Driving Test First Time. About Our Driving Lessons in Cheltenham. First Class Driving School in Cheltenham offers top quality Driving Lessons at a very competitve Price. All of our Driving Instructors are fully qualified and registered with the Driving Standards Agency (D.S.A). Our Driving School has been delivering first class driving lessons in Cheltenham since 2001, having helped many students pass their driving test first time. When choosing your driving school please check to make sure you are ...
TOTAL PAGES IN THIS WEBSITE
4
Set Up a Driving School Website | Home
http://www.setupadrivingschool.com/index.html
SET UP A DRIVING SCHOOL. DRIVING SCHOOL WEBSITE DESIGN. Website: Driving Lessons Leeds. A 5 page website for a driving school based in Leeds. Page 1 on Google. Very professional layout. Plenty of content for the learner driver. Website: Driving School Nottingham. A more complex website for a driving school Nottingham. Again Page 1 on Google. Basic design with alot of extra pages added. Website on Page 1. Well ranked website for a Driving School in Kidderminster. Page 1 on Google. Set up a Driving School.
TOTAL LINKS TO THIS WEBSITE
2
Driving Lessons Chatham - Driving Lessons in Chatham
Call today to start your driving experience Tel: 0845 838 1969. Driving lessons Chatham Chatham Driving Lessons. From beginners to refresher courses our Chatham Driving lessons will be tailor made to suit the individual including help with theory and basic car maintenance. We maintain a high level of professionalism and our instructors are patient and reliable so even the most nervous pupil will feel at ease. For our price list and click. To book a lesson.
drivinglessonscheadlehulme.co.uk
Driving Lessons Cheadle Hulme
Angela's School of Motoring provides driving lessons in Stockport and Driving tuition in Stockport. Angela provides experienced tuition at very competitive prices, with excellent pass rates. Click on the image above to visit our main website at www.angeladrivingschool.co.uk. Email at info@angeladrivingschool.co.uk. Or call Angela on 07979 084494.
drivinglessonschelmsford.com
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
drivinglessonschelsea.com
Web Hosting, Reseller Hosting & Domain Names from Heart Internet
This domain has been registered by Heart Internet if you are the owner of this domain please login. Unlimited web hosting packed full of great hosting features, from only £2.49 per month. Find out more about our unlimited web hosting. Make money selling unlimited websites, domain names and more with our white label reseller hosting package. Great value domain names from only £2.79 per year. Already have a domain? Transfer in your domain for free. The UK's Best Reseller Package. Own Branded Control Panel.
Driving Lessons Cheltenham | Andy1st Driving School
Pass Driving Test First Time. Excellent price for beginners. Courses to suit everyone. High Grade Driving Instructors in Cheltenham. Learn to Drive with Andy1st. Make the perfect choice. Pass Test 1st Time with our Driving School. Manual and Automatic cars available. Prices. Latest, modern dual controlled cars. Clean and tidy cars. Relax and enjoy your lessons. Services. Driving Lessons in Cheltenham : Contact Details. Or like to book a lessons then. Contact Andy1st. Manual Driving Lessons Cheltenham.
Driving Lessons Chertsey by Surrey Driving Force
If you'd like more information please enter your details below and we'll call you back. Driving lessons in Chertsey. Start at just £15.00. We cover all towns and cities Chertsey including Burpham, Goldsworth Park, Chertsey, Kingfield, Merrow, Pyrford, Ripley, Send, Woking, Worplesdon. Our Chertsey driving lessons. Offer all of this and more:. Friendly, patient and fully qualified Driving Instructors. Test success in as few lessons as possible. Convenient pick-ups from home, work or school. We recommend a...
drivinglessonscheshireandstaffs.com
Driving Lessons Crewe, Try Us and See Deal, 10 Hrs - £173
Choosing Your Driving School. Passed John Murphy From Crewe. Passed Jason Cooper From Crewe. Passed Richard Pattinson From Crewe. Passed Kerry Talbot From Crewe. Passed Keiron Herron From Crewe. Passed Amy Harrison From Crewe. Passed Alice White Weston Near Crewe. Passed Kerry Hillyer From Crewe. Passed Alex Sinclair From Crewe. Passed Alex Moore From Crewe. Passed Chris Hough From Alsager. Passed Ant Jones From Crewe. Passed Amy Woodall From Crewe. Passed Seb Wilson From Crewe. Passed Callum Briddon fro...
Driving lessons Cheshunt
The Vallé Academy Driving School. Driving School Providing Driving Lessons in Cheshunt and around Hertfordshire. Listed in the YFS business directory. In the Driving Lessons Cheshunt category. Tel Sarah : 07790 897112. So you are interested in driving lessons and learning to Drive with. The Vallé Driving School. Cheshunt but havent a clue where to start? Instructor Exclusive access to the DSA GOVERNMENT GATEWAY. NEW TEST CANCELLATION CHECKER! To the Government Gateway for Test Bookings which means that w...
Driving Lessons in Chester and surrounding areas
Driving Lessons Chester and Wrexham. Highly Experienced Driving Instructor in Chester, Wrexham and surrounding areas. Some learner drivers may never have driven before and be nervous and require lots of practice and encouragement. Teaching in a safe and confident manner. Andy is constantly up to date with current teaching methods and a programme of continued professional development, so you can be guaranteed of the finest standard of learning around. Please call Andy on 01244 557 007.
drivinglessonschestercountypapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
