
drivinglessonschester.com
Driving Lessons in Chester and surrounding areasDriving Lessons in Chester and surrounding areas
http://www.drivinglessonschester.com/
Driving Lessons in Chester and surrounding areas
http://www.drivinglessonschester.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
2 seconds
16x16
32x32
Fundacion Private Whois
Domain Administrator
Attn: drivingless●●●●●●●●●●●●●●●●●Aptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
Fundacion Private Whois
Domain Administrator
Attn: drivingless●●●●●●●●●●●●●●●●●Aptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
Fundacion Private Whois
Domain Administrator
Attn: drivingless●●●●●●●●●●●●●●●●●Aptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
14
YEARS
1
MONTHS
19
DAYS
INTERNET.BS CORP.
WHOIS : whois.internet.bs
REFERRED : http://www.internet.bs
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
0
SITE IP
192.185.140.194
LOAD TIME
1.982 sec
SCORE
6.2
Driving Lessons in Chester and surrounding areas | drivinglessonschester.com Reviews
https://drivinglessonschester.com
Driving Lessons in Chester and surrounding areas
Web Hosting, Reseller Hosting & Domain Names from Heart Internet
This domain has been registered by Heart Internet if you are the owner of this domain please login. Unlimited web hosting packed full of great hosting features, from only £2.49 per month. Find out more about our unlimited web hosting. Make money selling unlimited websites, domain names and more with our white label reseller hosting package. Great value domain names from only £2.79 per year. Already have a domain? Transfer in your domain for free. The UK's Best Reseller Package. Own Branded Control Panel.
Driving Lessons Cheltenham | Andy1st Driving School
Pass Driving Test First Time. Excellent price for beginners. Courses to suit everyone. High Grade Driving Instructors in Cheltenham. Learn to Drive with Andy1st. Make the perfect choice. Pass Test 1st Time with our Driving School. Manual and Automatic cars available. Prices. Latest, modern dual controlled cars. Clean and tidy cars. Relax and enjoy your lessons. Services. Driving Lessons in Cheltenham : Contact Details. Or like to book a lessons then. Contact Andy1st. Manual Driving Lessons Cheltenham.
Driving Lessons Chertsey by Surrey Driving Force
If you'd like more information please enter your details below and we'll call you back. Driving lessons in Chertsey. Start at just £15.00. We cover all towns and cities Chertsey including Burpham, Goldsworth Park, Chertsey, Kingfield, Merrow, Pyrford, Ripley, Send, Woking, Worplesdon. Our Chertsey driving lessons. Offer all of this and more:. Friendly, patient and fully qualified Driving Instructors. Test success in as few lessons as possible. Convenient pick-ups from home, work or school. We recommend a...
drivinglessonscheshireandstaffs.com
Driving Lessons Crewe, Try Us and See Deal, 10 Hrs - £173
Choosing Your Driving School. Passed John Murphy From Crewe. Passed Jason Cooper From Crewe. Passed Richard Pattinson From Crewe. Passed Kerry Talbot From Crewe. Passed Keiron Herron From Crewe. Passed Amy Harrison From Crewe. Passed Alice White Weston Near Crewe. Passed Kerry Hillyer From Crewe. Passed Alex Sinclair From Crewe. Passed Alex Moore From Crewe. Passed Chris Hough From Alsager. Passed Ant Jones From Crewe. Passed Amy Woodall From Crewe. Passed Seb Wilson From Crewe. Passed Callum Briddon fro...
Driving lessons Cheshunt
The Vallé Academy Driving School. Driving School Providing Driving Lessons in Cheshunt and around Hertfordshire. Listed in the YFS business directory. In the Driving Lessons Cheshunt category. Tel Sarah : 07790 897112. So you are interested in driving lessons and learning to Drive with. The Vallé Driving School. Cheshunt but havent a clue where to start? Instructor Exclusive access to the DSA GOVERNMENT GATEWAY. NEW TEST CANCELLATION CHECKER! To the Government Gateway for Test Bookings which means that w...
Driving Lessons in Chester and surrounding areas
Driving Lessons Chester and Wrexham. Highly Experienced Driving Instructor in Chester, Wrexham and surrounding areas. Some learner drivers may never have driven before and be nervous and require lots of practice and encouragement. Teaching in a safe and confident manner. Andy is constantly up to date with current teaching methods and a programme of continued professional development, so you can be guaranteed of the finest standard of learning around. Please call Andy on 01244 557 007.
drivinglessonschestercountypapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
drivinglessonschesterfield.com
Driving Lessons in Chesterfield - Roads Ahead Driving School
Driving in the Snow. Teach your Children to Drive. Driving Lessons in Chesterfield Driving School in Chesterfield Driving School in Newbold Driving Tuition in Chesterfield Driving Tuition in Newbold Driving Instructor in Chesterfield Driving Instructor in Newbold. Welcome to Roads Ahead Driving School. Roads Ahead Driving School. Is solely owned by Stuart Yeowart, DVSAADI, MAIRSO, who offers Driving Tuition in and around the Chesterfield area for new and more experienced drivers. Advanced police drivers ...
drivinglessonschesterfield.org
Driving Lessons Chesterfield | Andy1st Driving School
Pass Driving Test First Time. Bargain driving lessons . Learn to Drive at a pace that suits you. Driving Instructors in Chesterfield, all fully qualified. Beginners start up offer ONLY 10 per hour for 5 lessons. First 5 Lessons Only 10 each. Great discounts for booking in bulk. Costs. Pass Driving Test 1st Time @ Andy1st. Very High, above average, First Time Pass Rates. Courses. Enjoy your Driving Lessons in Chesterfield. Contact Andy1st for prices and bookings. Call / Email. At Andy1st we have various d...
drivinglessonschesterfield.org.uk
Chesterfield Driving Lessons
Graham's School of Motoring. Driving Lessons in Chesterfield. Call us now for an informal chat. Land Line: 01246 556315. Content on this page requires a newer version of Adobe Flash Player. View all of our reviews. On the FreeIndex Driving Instructors directory.
Driving School Chilliwack, Driving School Abbotsford
The Art of Driving. Janelle and the rest of us all are soooooo excited for her and this new-found freedom she will finally have. Thanks for being there and helping her get her 'N' You ARE THE BEST! We Teach Safe Driving. Click Here To Read Our Facebook Reviews! Teaching a new driver on your own can be a daunting task. Most parents attempt to teach their son/daughter on their own but, if you are asking yourself, "Why is my son/daughter making the same driving error despite repeated practice? We have great...