getawaycar.com getawaycar.com

GETAWAYCAR.COM

Home | GETAWAYCAR

[gallery display=

http://www.getawaycar.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR GETAWAYCAR.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

February

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Monday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 3.3 out of 5 with 6 reviews
5 star
2
4 star
0
3 star
3
2 star
0
1 star
1

Hey there! Start your review of getawaycar.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

2.5 seconds

FAVICON PREVIEW

  • getawaycar.com

    16x16

  • getawaycar.com

    32x32

  • getawaycar.com

    64x64

  • getawaycar.com

    128x128

CONTACTS AT GETAWAYCAR.COM

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
GE●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
GE●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
GE●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
1998 February 24
UPDATED
2014 February 24
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 27

    YEARS

  • 8

    MONTHS

  • 4

    DAYS

NAME SERVERS

1
ns.inmotionhosting.com
2
ns2.inmotionhosting.com

REGISTRAR

GODADDY.COM, LLC

GODADDY.COM, LLC

WHOIS : whois.godaddy.com

REFERRED : http://registrar.godaddy.com

CONTENT

SCORE

6.2

PAGE TITLE
Home | GETAWAYCAR | getawaycar.com Reviews
<META>
DESCRIPTION
[gallery display=
<META>
KEYWORDS
1 getawaycar
2 productions
3 getawaycar
4 nbc
5 promos
6 writer
7 editor
8 producer
9
10 coupons
CONTENT
Page content here
KEYWORDS ON
PAGE
toggle navigation,welcome,branded,promos,virtual reality,docs baby,really virtual,hannibal smells dinner,contact info
SERVER
Apache
POWERED BY
PHP/5.5.38
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Home | GETAWAYCAR | getawaycar.com Reviews

https://getawaycar.com

[gallery display=

INTERNAL PAGES

getawaycar.com getawaycar.com
1

About Getawaycar Productions Founder

http://getawaycar.com/about.html

Getawaycar Productions was originally branded during a weekend road trip that became a year-long visit to every state in the continental United States and over 120 interviews recorded with Americans on their thoughts about the 21st Century. Others may claim you can take their credentials to the bank. That bank is in our rear-view mirror. More about Getawaycar's founder.

2

GETAWAYCAR Clients

http://getawaycar.com/clients.html

Sony Computer Entertainment America. San Francisco Independent Film Festival.

3

Contact GETAWAYCAR

http://getawaycar.com/files.html

Coming down the road:. We will have secure file transfers for client uploads and exchange.

4

GETAWAYCAR REEL

http://getawaycar.com/reel.html

Lace is a lot to handle. Promo for a creepy family. Launch promo for NBC's. Hannibal showing off his. THE INCREDIBLE DR. POL :30. Promo for an unconventional. Veterinarian on Nat Geo Wild. The music should be familiar. BEST TIME EVER :60. Neil Patrick Harris pitches. His new show by doing. Character profile of a man who. Has not looked all that great. BLACKLIST/S.O.A. :30. Introducing the audience of. The Blacklist' to a new show. PETER PAN LIVE :30. Promo for the live musical. SAMSUNG: NEXT BIG THING :60.

UPGRADE TO PREMIUM TO VIEW 0 MORE

TOTAL PAGES IN THIS WEBSITE

4

OTHER SITES

getawaycampers.nl getawaycampers.nl

Camper huren - Campers

Campers Verhuur, verkoop. Steeds meer mensen die er voor kiezen om een reis te boeken maken de bewuste keuze om een camper te huren. Een camper huren is een ideale manier om een land te ontdekken en haar cultuur te leren kennen. Ben je van plan om ook een reis te maken naar het buitenland en wil je tijdens die reis graag genieten van een ongekende vrijheid? In dat geval is een camper huren voor jou ongetwijfeld een interessante keuze! Goedkoop een camper huren. Camper huren in het buitenland. The Nationa...

getawaycampground.com getawaycampground.com

Georgia Campground on the Altamaha River, visit Getaway Campground Georgia’s kayaking, canoeing, fishing, hunting and camping. Big Hammock a Ga. Wildlife Management Area, WMA fo - Home

Georgia Campground on the Altamaha River, visit Getaway Campground Georgia’s kayaking, canoeing, fishing, hunting and camping. Big Hammock a Ga. Wildlife Management Area, WMA fo. Contact campground for reservations. Or call 912 256 4114 or 912-256-7118. The beautiful Altamaha River. The Altamaha River is one of the great natural treasures of the eastern United States, flowing undammed for its entire length. Sun, sand and lotion. View of swamp and river from air. Reptiles such as alligators and a variety ...

getawaycampthorlake.com getawaycampthorlake.com

Home

Welcome To Our Site! Welcome to Getaway Camp. We are located in a remote location in the North. It is approximately a 2 1/2 hour drive past Capreol, Ontario. You can also arrive by Via Rail which is approximately 1 hour train ride from Capreol.We have a bunk house fully equipped to sleep 14. We also have a 2 bedroom cabin also fully equipped. You can rent boats and motors on the premises,. There is access to many Walleye, Northern Pike and Bass Lakes as well as our own Thor Lake.

getawaycanada.com getawaycanada.com

getawaycanada.com Is For sale

Getawaycanada.com is for sale and can be yours TODAY. If interested in acquiring this domain, you can acquire it in CAD through MyID.ca Domain Marketplace HERE. If you prefer to pay USD and use escrow.com, you may contact us directly by following these simple 3 steps: 1) Send us an offer using CIRA contact us form. 2) We agree on a fair price 3) You start a transaction with escrow.com. Once funds are received, domain is yours.

getawaycanadavacations.com getawaycanadavacations.com

Bus in comfort your way, explore Canada|Getaway Canada Vacations

The best way to find the bus suitable for your group. -. We make it easy to get the best Quote!

getawaycar.com getawaycar.com

Home | GETAWAYCAR

Shark Week has bite. Do you love my hair? 2017 GETAWAYCAR PRODS. LLC 323-393-3488 driver@getawaycar.com.

getawaycaravanandcampinghire.com.au getawaycaravanandcampinghire.com.au

Campervan Rental & Camping Hire - Getaway Caravans

Who are Getaway Caravans. GETAWAY CARAVAN and CAMPING HIRE. Start a holiday with our getaway caravans and choose your own adventure! Adventure doesn’t need a destination – Wherever you are, that’s where you’ll be! As outdoor and travel enthusiasts, we started Getaway Caravan and Camping Hire on the dream of helping people enjoy their holidays with their families. We’d like to make it easier on you. The stress of planning a holiday can sometimes make the holiday itself redundant! Our campervans come ready...

getawaycaravanhire.com.au getawaycaravanhire.com.au

Getaway Caravan Hire

Adelaide, South Australia. Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Getaway's New Caravan Hire. Why Hire a Caravan? Items included in the Hire. And Terms and Conditions. Treat yourself to a Getaway. Header Photo: Granite Island looking back to Victor Harbor. Expanda 16.49.4.

getawaycard.com getawaycard.com

Discount Vacation Packages, Travel Deals, Expert Advice and Special Travel Offers... Save time and money!

Connect with Travel Agent Experts for EVERY. Type of Travel and Destination Worldwide! TripBlip - Deal Alerts. Signup For Deal Alerts.

getawaycarfilms.com getawaycarfilms.com

Will Brenton Holding 1

getawaycarhire.co.za getawaycarhire.co.za

Get-a-Way Car Hire - Home

Welcome to Get-a-Way Car Hire. We are proud to introduce our personally owned business, Get-a-Way Car Hire, to you. Our aim is to provide an excellent service whilst saving you money. In order to save you money, we run our business with no frills. We endeavour to make your car hire experience a pleasant one, with the hope that you will recommend us to your friends, family and acquaintances. We cater for all car hire requirements and also do weekly, monthly and long term car hire. Life is meant to be fun.