Getaway Caravan Hire is a family owned and run Caravan Hire company based in Adelaide, South Australia. We can provide you with everything you need for a self-tow holiday or we can take the van to a place of your choice and set it up for you.
http://getawaycaravanhire.com.au/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.3 seconds
PAGES IN
THIS WEBSITE
6
SSL
EXTERNAL LINKS
9
SITE IP
202.146.214.150
LOAD TIME
0.344 sec
SCORE
6.2
Getaway Caravan Hire | getawaycaravanhire.com.au Reviews
https://getawaycaravanhire.com.au
Getaway Caravan Hire is a family owned and run Caravan Hire company based in Adelaide, South Australia. We can provide you with everything you need for a self-tow holiday or we can take the van to a place of your choice and set it up for you.
getawaycaravanhire.com.au
Getaway Caravan Hire
http://www.getawaycaravanhire.com.au/index.html
Adelaide, South Australia. Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Getaway's New Caravan Hire. Why Hire a Caravan? Items included in the Hire. And Terms and Conditions. Treat yourself to a Getaway. Header Photo: Granite Island looking back to Victor Harbor. Expanda 16.49.4.
Eagle Tourer
http://www.getawaycaravanhire.com.au/eagletourer.html
Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Sleeps: up to 6 persons. Discounts apply for periods over 14 days. Expanda 16.49.4.
Eagle Outback
http://www.getawaycaravanhire.com.au/eagleoutback.html
Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Sleeps: up to 6 persons. Discounts apply for periods over 14 days. Expanda 16.49.4.
Expanda 16.49-4
http://www.getawaycaravanhire.com.au/expanda16_49_4.html
Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Jayco Expanda 16.49-4. Sleeps: up to 6 persons. Discounts apply for periods over 14 days. Expanda 16.49.4.
Expanda 14.44.4
http://www.getawaycaravanhire.com.au/expanda14_44_4.html
Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Jayco Expanda 14.44-4. Sleeps: up to 4 persons. Discounts apply for periods over 14 days. Expanda 16.49.4.
TOTAL PAGES IN THIS WEBSITE
6
Blogs - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/blogs
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! Business Affiliate - Campedia Australia. Live2Camp.com.au' - our latest Business Affiliates! We will definitely use your company again! We'll definitely be back! NINGALOO REEF WESTERN AUS CARAVAN HIRERS FEEDBACK! Business Affiliate – Campedia Australia. 8216;Live2Camp.com.au’ – our latest Business Affiliates! We will definitely use your company again! We’ll definitely be back! Have a general question? Send us an email!
Caravan Hire Media - Caravan and Camping Hire
https://caravanandcampinghire.com.au/media
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! Jayco Instructional Media / Videos. Customline Tent Camper Trailer Setup. Jayco Camper Trailer Setup. Jayco Swan Outback Setup. Jayco Poptop ‘Bagged Awning and Annex’ Setup. Swan, Eagle, Hawk, Dove etc). 2013 GIC Camper Trailer Setup. 2011/12 Oztrail Marlin Camper Trailer Setup. Have a general question? Send us an email! Want to become a C&C Hire Partner? Time to get away on a holiday? Click here to get started!
Hire out Yours! - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/hire-out-your-rv
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! City/Suburb/Town* (Caravan Pickup Location). Type: Various Types and Tents. Caravan Make and Model*. Short Welcome Description not more than 200 Characters*. CIL Insurance RCV number*. Select all your Caravn Features*. Cutlery, Crockery, Cooking Pots and Pans. Fold down Dinette Area/Sleeping area. Other Caravan Features not listed in above list. Caravan Hire Rate per day(*). Do you allow Pets? Do you allow Children?
Products Archives - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/product-category/products
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! Showing all 5 results. Sort by average rating. Sort by price: low to high. Sort by price: high to low. Portable Electric Brake Units (PEBs). 12 to 7 Flat Pin Adaptors. Caravan Covers & Stone Guards. Have a general question? Send us an email! Want to become a C&C Hire Partner? Time to get away on a holiday? Click here to get started! List my RV for Hire. Become a Hire Partner.
Private Caravan Hire, Camper Hire & Motorhome Hire Australia
https://caravanandcampinghire.com.au/caravan-hire
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! How Does it All Work? 8211; Caravan Hire. How Does it All Work? 8211; Caravan Hire. HOW HIRING OUT YOURS ALL WORKS! We are paying back tens of thousands of dollars to individual owners (our Hire Partners) every year just for Hiring our their Caravans, Campers and Motorhomes with Caravan and Camping Hire! These Hire Partners below have already made over $10,000 net Hire Income in just 6 months. Bond payments and refunds.
Booking Enquiry Form - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/booking-enquiry-form
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! Select a state…. Please Select One -. Please Select One -. Select One State -. Vehicle Model and Year*. Braked Towing Capacity (kg)*. My vehicle has electric brakes fitted. Vehicle Model and Year:. Brake Towing Capacity (kg):. My vehicle has electric brakes fitted:. Have a general question? Send us an email! Want to become a C&C Hire Partner? Time to get away on a holiday? Click here to get started! List my RV for Hire.
Hire - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/hire
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! Hire a Caravan or Camping Trailer. Hire a Caravan or Camper. We don't have any hire partners there yet. Surrey Hills / VIC. Please choose a type:. We don't have any hire partners there yet. Have a general question? Send us an email! Want to become a C&C Hire Partner? Time to get away on a holiday? Click here to get started! List my RV for Hire. Become a Hire Partner.
About Us - Caravan and Camping Hire AUS
https://caravanandcampinghire.com.au/about-us
C n C Hire Relocation Services. C n C Hire Relocation Services. Hire out yours FAQs! We are Caravan and Camping Hire Australia. Australia’s No. 1 Peer 2 Peer Caravan/RV/Camper Hiring Community. At Caravan and Camping Hire Australia (C n C Hire AUS) we strive to achieve 2 main things:. ANY family/couple/individual the opportunity to enjoy Caravan/Camping holidays by hiring one any one of our beautiful privately owned Hire Vehicles. This is an astounding 30% or more return on their investments.
TOTAL LINKS TO THIS WEBSITE
9
Home
Welcome To Our Site! Welcome to Getaway Camp. We are located in a remote location in the North. It is approximately a 2 1/2 hour drive past Capreol, Ontario. You can also arrive by Via Rail which is approximately 1 hour train ride from Capreol.We have a bunk house fully equipped to sleep 14. We also have a 2 bedroom cabin also fully equipped. You can rent boats and motors on the premises,. There is access to many Walleye, Northern Pike and Bass Lakes as well as our own Thor Lake.
getawaycanada.com Is For sale
Getawaycanada.com is for sale and can be yours TODAY. If interested in acquiring this domain, you can acquire it in CAD through MyID.ca Domain Marketplace HERE. If you prefer to pay USD and use escrow.com, you may contact us directly by following these simple 3 steps: 1) Send us an offer using CIRA contact us form. 2) We agree on a fair price 3) You start a transaction with escrow.com. Once funds are received, domain is yours.
Bus in comfort your way, explore Canada|Getaway Canada Vacations
The best way to find the bus suitable for your group. -. We make it easy to get the best Quote!
Home | GETAWAYCAR
Shark Week has bite. Do you love my hair? 2017 GETAWAYCAR PRODS. LLC 323-393-3488 driver@getawaycar.com.
getawaycaravanandcampinghire.com.au
Campervan Rental & Camping Hire - Getaway Caravans
Who are Getaway Caravans. GETAWAY CARAVAN and CAMPING HIRE. Start a holiday with our getaway caravans and choose your own adventure! Adventure doesn’t need a destination – Wherever you are, that’s where you’ll be! As outdoor and travel enthusiasts, we started Getaway Caravan and Camping Hire on the dream of helping people enjoy their holidays with their families. We’d like to make it easier on you. The stress of planning a holiday can sometimes make the holiday itself redundant! Our campervans come ready...
Getaway Caravan Hire
Adelaide, South Australia. Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Getaway's New Caravan Hire. Why Hire a Caravan? Items included in the Hire. And Terms and Conditions. Treat yourself to a Getaway. Header Photo: Granite Island looking back to Victor Harbor. Expanda 16.49.4.
Discount Vacation Packages, Travel Deals, Expert Advice and Special Travel Offers... Save time and money!
Connect with Travel Agent Experts for EVERY. Type of Travel and Destination Worldwide! TripBlip - Deal Alerts. Signup For Deal Alerts.
Will Brenton Holding 1
Get-a-Way Car Hire - Home
Welcome to Get-a-Way Car Hire. We are proud to introduce our personally owned business, Get-a-Way Car Hire, to you. Our aim is to provide an excellent service whilst saving you money. In order to save you money, we run our business with no frills. We endeavour to make your car hire experience a pleasant one, with the hope that you will recommend us to your friends, family and acquaintances. We cater for all car hire requirements and also do weekly, monthly and long term car hire. Life is meant to be fun.
Home - Event planning companies
Home - Event planning companies. Home - Event planning companies. Learn more about event planning companies.
Main Line Singers
Great to see you. Thanks for popping in! Main Line Singers is a new community chorus based on the Main Line in the beautiful suburbs of Philadelphia. We are focused on performing a fun and accessible repertoire drawn from Broadway, Hollywood, and popular music. Our mission is to enhance our community through music - and by being totally awesome people in general! A chorus brings incredible health benefits to the singers, enrichment to the listeners and joy and education to all! Of ability who . Join in t...
