getawaycaribbean.com

getawaycaravanandcampinghire.com.au

Campervan Rental & Camping Hire - Getaway Caravans

Who are Getaway Caravans. GETAWAY CARAVAN and CAMPING HIRE. Start a holiday with our getaway caravans and choose your own adventure! Adventure doesn’t need a destination – Wherever you are, that’s where you’ll be! As outdoor and travel enthusiasts, we started Getaway Caravan and Camping Hire on the dream of helping people enjoy their holidays with their families. We’d like to make it easier on you. The stress of planning a holiday can sometimes make the holiday itself redundant! Our campervans come ready...

getawaycaravanhire.com.au

Getaway Caravan Hire

Adelaide, South Australia. Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Getaway's New Caravan Hire. Why Hire a Caravan? Items included in the Hire. And Terms and Conditions. Treat yourself to a Getaway. Header Photo: Granite Island looking back to Victor Harbor. Expanda 16.49.4.

getawaycard.com

Discount Vacation Packages, Travel Deals, Expert Advice and Special Travel Offers... Save time and money!

Connect with Travel Agent Experts for EVERY. Type of Travel and Destination Worldwide! TripBlip - Deal Alerts. Signup For Deal Alerts.

getawaycarfilms.com

Will Brenton Holding 1

getawaycarhire.co.za

Get-a-Way Car Hire - Home

Welcome to Get-a-Way Car Hire. We are proud to introduce our personally owned business, Get-a-Way Car Hire, to you. Our aim is to provide an excellent service whilst saving you money. In order to save you money, we run our business with no frills. We endeavour to make your car hire experience a pleasant one, with the hope that you will recommend us to your friends, family and acquaintances. We cater for all car hire requirements and also do weekly, monthly and long term car hire. Life is meant to be fun.

getawaycaribbean.com

Home - Event planning companies

Home - Event planning companies. Home - Event planning companies. Learn more about event planning companies.

getawaycarr.com

Main Line Singers

Great to see you. Thanks for popping in! Main Line Singers is a new community chorus based on the Main Line in the beautiful suburbs of Philadelphia. We are focused on performing a fun and accessible repertoire drawn from Broadway, Hollywood, and popular music. Our mission is to enhance our community through music - and by being totally awesome people in general! A chorus brings incredible health benefits to the singers, enrichment to the listeners and joy and education to all! Of ability who . Join in t...

getawaycarrentals.com

InMotion Hosting

Your IP is 66.160.134.2.

getawaycars.nl

Getaway Cars » Voor elke gelegenheid een unieke auto

Voor elke gelegenheid een unieke auto. Welcome to Getaway Cars! Mijn naam is Martin van der Zeijden en samen met mijn familie zijn wij gek van oldtimers! Zoeken op de site. Blijf op de hoogte van bedrijfsnieuws en ontwikkelingen! 2224 DA Katwijk (Bollenstreek). Tel 06 - 40488832.

getawaycash.com

Non-Existent Domain

Your browser does not support iframes, please click here.

getawaycatering.com

Home

Welcome to Getaway CateringLLC. Let us plan and cater the event of your Dreams. Weddings, Parties, and More. For many years we have been a full service catering company. When you want the job done right we are your answer. We make every celebration extraordinary and help you create cherished memories with personalized service, unsurpassed cuisine and meticulous attention to detail. From simple to extravagant, you will experience excellence.