independencemallde.com
Independence Mall - A place to make your own history
Independence Mall - A place to make your own history. Photos of Sample Spaces. A place to make your own history. Welcome to Independence Mall. Retail and office shopping complex. Independence Mall gives an extended welcome to the tenants that have recently joined our family, recently renewed their lease, or expanded into larger space:. Kat Geralis Home Team. Breakwater Acct Advisory Corp. Postcard from the mid-1960's commemorating Independence Mall.
independenceman.com
Independence Man | Living Empowered And Free Guided By Love
Podcast Episode 001: Intruduction. The first Episode is up! It's an introduction into what the Independence Man Podcast is about, why I picked the name, the general themes and some of the more specific areas I am excited about sharing with everyone. Love is the most powerful force in the universe. Learn the 3 ways to that you can gain more Love in your own life in a powerful way. Podcast Episode 003: Exploring Freedom. I have played small for to long. Check us out on iTunes. Find me on Facebook. I am a l...
independencemanagementcorp.com
Independence Management Corporation - Home
Don't have an account? Create your account,. It takes less than a minute. User registration is not enabled. Enter your email address and we'll send you a link you can use to pick a new password. Call Us Today: 1-248-625-1188. Welcome to Independence Management Corp. Business and property management services. Independence Management Corporation,. All of the properties held and managed by Independence Management are in prime locations, well managed, and impeccably maintained to the highest levels in the in...
independencemanicure.com
independencemanicure.com
The domain independencemanicure.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
independencemanicures.com
independencemanicures.com
The domain independencemanicures.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
independencemanor.com
Independence Manor
Features & Amenities. Promoting a residents right to self-reliance by providing personalized services in a caring, home like setting, where seniors maintain a sense of dignity and self-esteem. Residents are surrounded by beautiful architectural design in the master dining room and other living spaces throughout Independence Manor. Independence Manor provides all different outlets of activities for its residents on a daily basis. 188 State Highway 31. Flemington, NJ 08822. Behind BJs and CVS). The Nagle f...
independencemap.com
IndependenceMap.com is for sale!
Domain name is for sale! The form accepts at least 25% the asking price, $25. Please correct the following and resubmit, thanks! 1 (725) 222 9 777.
independencemarine.com
Marine Parts and Service at its best… - Independence Marine
IndependenceMarine.com – Coming Soon…. Stay tuned for something awesome!
independencemarket.com
Independence Market
Our website is in preparation. For enquires please contact us at.
independencemarketingservices.com
Independence Marketing Services, Inc.
Rely on Independence Marketing Services to deliver success! Rely on IMS to create campaigns customized to meet your marketing needs. Rely on IMS to. Create immediate business and ongoing customer relationships. Rely on IMS to. Schedule appointments with qualified prospects. Rely on IMS to increase your sales team's productivity and reduce your sales cost! Rely on IMS to. Obtain referrals for prospecting databases. Rely on IMS to. Follow-up on old, cold or recent leads. Bringing more customers to YOU!
independencemarketingservices.info
www.independencemarketingservices.info
This Web page parked FREE courtesy of WebsiteSpot.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $7.99/mo. Call us any time day or night (480) 624-2500.
SOCIAL ENGAGEMENT