independencemanicures.com
independencemanicures.com
The domain independencemanicures.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
independencemanor.com
Independence Manor
Features & Amenities. Promoting a residents right to self-reliance by providing personalized services in a caring, home like setting, where seniors maintain a sense of dignity and self-esteem. Residents are surrounded by beautiful architectural design in the master dining room and other living spaces throughout Independence Manor. Independence Manor provides all different outlets of activities for its residents on a daily basis. 188 State Highway 31. Flemington, NJ 08822. Behind BJs and CVS). The Nagle f...
independencemap.com
IndependenceMap.com is for sale!
Domain name is for sale! The form accepts at least 25% the asking price, $25. Please correct the following and resubmit, thanks! 1 (725) 222 9 777.
independencemarine.com
Marine Parts and Service at its best… - Independence Marine
IndependenceMarine.com – Coming Soon…. Stay tuned for something awesome!
independencemarket.com
Independence Market
Our website is in preparation. For enquires please contact us at.
independencemarketingservices.com
Independence Marketing Services, Inc.
Rely on Independence Marketing Services to deliver success! Rely on IMS to create campaigns customized to meet your marketing needs. Rely on IMS to. Create immediate business and ongoing customer relationships. Rely on IMS to. Schedule appointments with qualified prospects. Rely on IMS to increase your sales team's productivity and reduce your sales cost! Rely on IMS to. Obtain referrals for prospecting databases. Rely on IMS to. Follow-up on old, cold or recent leads. Bringing more customers to YOU!
independencemarketingservices.info
www.independencemarketingservices.info
This Web page parked FREE courtesy of WebsiteSpot.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $7.99/mo. Call us any time day or night (480) 624-2500.
independencemarketplace.com
Classifieds | The Marketplace for Independence Missouri
The Marketplace for Independence Missouri. 28 Days, 21 hours. Apr 2, 2017 at 6:20 AM. 28 Days, 21 hours. Your name or email address:. Powered by Classifieds 2015-2016 GoodForNothing™ Labs. The Marketplace for Independence Missouri. Separate names with a comma.
independencemartialarts.com
Independence Martial Arts & Fitness | AKKA Independence
Kid’s Martial Arts. Teen’s Martial Arts. Secure your spot and get started today with our EXCLUSIVE offer! First and Last Name *. Select a Program *. Kid's Martial Arts. Teen's Martial Arts. Secure your spot and get started today with our EXCLUSIVE offer! First and Last Name *. Select a Program *. Kid's Martial Arts. Teen's Martial Arts. My 16 year old son, 11 year old son, and myself are loving taking karate as a family at AKKA! I highly recommend this karate school to anyone at any age! Secure your spot...
independencemate.com
independencemate.com
independencematters.co.uk
Independence Matters | Working together to help you live an independent life
Working together to help you live an independent life. Skip to primary content. Skip to secondary content. At that stage knowing who to turn to and what your options are becomes important. Do I need to go into a home or can I live in my own home? How much will it all cost? Will I have to pay? What are the alternatives? Who can support me through all this? Can I get physiotherapy rehabilitation at home? How long will it take to organise? What will it involve? Can they treat my problem? As experienced soci...
SOCIAL ENGAGEMENT