A leading travel partner providing ticketing, accommodation booking, competitive fares, professional support and exceptional visa services. Hassle free boarding
http://swifttravel.com.pk/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
2.2 seconds
PAGES IN
THIS WEBSITE
11
SSL
EXTERNAL LINKS
0
SITE IP
50.31.114.44
LOAD TIME
2.172 sec
SCORE
6.2
Swift Travel | The best travel companion you can get | swifttravel.com.pk Reviews
https://swifttravel.com.pk
A leading travel partner providing ticketing, accommodation booking, competitive fares, professional support and exceptional visa services. Hassle free boarding
swifttravel.com.pk
Cheap Vacation Packages and Holiday Deals | Swift Travel
https://www.swifttravel.com.pk/destinations
Call us now: 92 (21) 3583 7766. Sort by Default Order. Click to order products ascending. Display 6 Products per page. 6 Products per page. 12 Products per page. 18 Products per page. Blue Mosque in Turkey. Burj Khalifa in Dubai. Cape Town in South Africa. Eiffel Tower in Paris. Seaside Resorts in Phuket. Statue of Liberty in New York. Page 1 of 2. 92 (21) 3583 7766. 92 (21) 3587 9790. 92 (21) 3587 9785. E-Mail: bookings@swifttravel.com.pk. Opening Hours: 09:00 - 18:00. Site Managed by Brainstorm Inc.
Middle East | Swift Travel
https://www.swifttravel.com.pk/package-category/middle-east
Call us now: 92 (21) 3583 7766. Sort by Default Order. Click to order products ascending. Display 15 Products per page. 15 Products per page. 30 Products per page. 45 Products per page. Burj Khalifa in Dubai. 92 (21) 3583 7766. 92 (21) 3587 9790. 92 (21) 3587 9785. E-Mail: bookings@swifttravel.com.pk. Opening Hours: 09:00 - 18:00. Site Managed by Brainstorm Inc.
Corporate Flight & Hotel Bookings | Swift Travel
https://www.swifttravel.com.pk/corporate-flight-hotel-bookings
Call us now: 92 (21) 3583 7766. We are based locally and have dozens of years of experience. In travel industry. We offer high value packages owing to bulk agreements with hotels and other service providers. Swift Travels offers special fares. To match your budget in Economy, Premium Economy, Business and First; with flexible conditions unique to corporate travel. We still believe in the power of great service. We achieve it by giving you a dedicated travel team. Without charges are some of the benefits ...
Eiffel Tower in Paris | Swift Travel
https://www.swifttravel.com.pk/package/eiffel-tower-in-paris
Call us now: 92 (21) 3583 7766. The iconic Wonder of The World. Indulge in Amazing Food and Baked Specialities. Paris, France’s capital, is a major European city and a global center for art, fashion, gastronomy and culture. Its 19th-century cityscape is crisscrossed by wide boulevards and the River Seine. Beyond such landmarks as the Eiffel Tower. And the 12th-century, Gothic Notre-Dame cathedral, the city is known for its cafe culture and designer boutiques along the Rue du Faubourg Saint-Honoré. Honeym...
Statue of Liberty in New York | Swift Travel
https://www.swifttravel.com.pk/package/statue-of-liberty-in-new-york
Call us now: 92 (21) 3583 7766. Stroll the Famous Times Square. Three Mile Long Golden Gate Bridge. United States of America. New York City comprises 5 boroughs sitting where the Hudson River meets the Atlantic Ocean. At its core is Manhattan, a densely populated borough that’s among the world’s major commercial, financial and cultural centers. Its iconic sites include skyscrapers such as the Empire State Building. And sprawling Central Park. Broadway theater is staged in neon-lit Times Square. Honeymoon...
TOTAL PAGES IN THIS WEBSITE
11
Electric Mouse Trap
Monday, 24 October 2011. Get the best electric Mouse Trap. Electric mouse trap is the most innovative invention to trap mouse without any stress. It is the best alternative to trap mouse without any harm. Most of the people love animals and therefore, they do not want to kill small mouse or mice by some inhumane way. Electric mouse trap. Helps those people to trap mouse without provide any physical harm. Both the traditional as well as electronic mice traps. Before using an electronic mouse trap. Is the ...
swifttrap | Just another WordPress.com site
Just another WordPress.com site. Get the best electric Mouse Trap. October 25, 2011. Electric mouse trap is the most innovative invention to trap mouse without any stress. It is the best alternative to trap mouse without any harm. Most of the people love animals and therefore, they do not want to kill small mouse or mice by some inhumane way. Electric mouse trap. Helps those people to trap mouse without provide any physical harm. To indicate that mouse has been killed. Now the only thing with the per...
Airport Transfers - York | Swift Travel
Airport Transfers - York Swift Travel home page. Executive travel in York, travelling across UK. Swift Travel have been providing quality executive travel and airport taxi services in York for over 16 years. Specialising in airport transfers, we cover all UK airports including Manchester, East Midlands, Newcastle, Gatwick and Heathrow. Why choose our taxi service? Smartly dressed driver at all times. Luxury vehicles including a Mercedes Viano. Complimentary water and mints in vehicles.
Premium travel made affordable / Swift Travel
Talk to a Swift Specialist. Premium travel made affordable. Access exclusive flight offers, hotels and services with Swift. Rtn from 511.00. London (LHR) - Dubai (DXB). Dubai (DXB) - London (LHR). Rtn from 693.00. London (LGW) - Orlando (MCO). Orlando (MCO) - London (LGW). Rtn from 734.00. London (LGW) - Tampa (TPA). Tampa (TPA) - London (LGW). Rtn from 763.00. Manchester (MAN) - New York (JFK). New York (JFK) - Manchester (MAN). Rtn from 764.00. London (LHR) - Delhi (DEL). Delhi (DEL) - London (LHR).
Swift Travel | The best travel companion you can get
Call us now: 92 (21) 3583 7766. To Travel is to live. Want to make a journey? We’ve got the destinations! We provide top rated services which enables you to save time and money. You get better flight connections, value for your money & better travel deals. One of our highly trained travel managers will be at your service 24/7. Alone or in groups…. Traveling was never easier! Want a family vacations abroad or within Pakistan? Planning one in a lifetime honeymoon by the beach? A few of our.
Swift Travel search for lowest fares from Swift Travel
Flight specialists since 2001. Welcome to Swift Travel. Search over 100 airlines for cheapest international flights from and to all countries, pay in 26 different currencies and credit cards. By using the comprehensive Swift Travel resources you will be able to search for flight date, destination and flight departure airport, for the flights to suit your individual travel requirements. Have a good cheap flight from Swift Travel UK. Swift Travel travel guides. South East Asia travel. Music from Spiral Frog.
HEM
Swift Travel ingår numera i Scanworld Lufthansa City center. Vänligen besök scanworld.se. För ytterligare information. För att komma i kontakt med oss, vänligen ring 08-475 00 40 eller maila: grupp@scanworld.se.
swifttravelandtour.com - This website is for sale! - swifttravelandtour Resources and Information.
The owner of swifttravelandtour.com. Is offering it for sale for an asking price of 1000 GBP! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
swifttraveldeals.americanpassportnow.com
American Passport Now
Lost or Stolen Passport. Tips for Women Travelers. Travel Document Solutions Experts. A Proud Partner of Swift Travel Deals. Is a well-established passport and visa expediting company and a. Proud partner to Swift Travel Deals. Our mission critical services are focused strictly on. When time is of the essence. In your global business, Meeting deadlines. For global travel is ours! What type of service do you need? 40 Years of Experience. Low Rates and Rush Delivery. US Department of State Licensed.
Swift Travel Deals
Why Book With Us. Request a Free Quote. Need a Travel Deal? Find My Travel Deal. Book Your Travel Online. Travel Information. Before you go. Make Your Payment Online. Make Your Payment Online. Easy Pay Installment Plan Form. Join Our Travel Teams! Become a Travel Consultant. Travel at Discounted Rates. Swift Travel Deals 2015. Enter your search terms below. Swift Travel Deals is an Arkansas based global travel agency that has been featured in over 100 news and media features in over 13 different countries.
SOCIAL ENGAGEMENT