1303218. getawaybunny – ISO perfect getaways, for an hour, a weekend, a month, or until your boss comes looking for you.
ISO perfect getaways, for an hour, a weekend, a month, or until your boss comes looking for you. Follow Blog via Email. Enter your email address to follow this blog and receive notifications of new posts by email. Join 19 other followers. View Full Profile →. Coo-Coo for Cocoa Beach. GB Quickie: Southwest Airline Video MUST SEE! Coo-Coo for Cocoa Beach. It’s also easy to reach. The closest airport is Orlando, about 50 minutes northwest (as are the Big O’s theme parks, if you’re so i...5300 O cean B e.
getawaybunny.wordpress.com 1303219. Getaway Bus Inc. :: Vans, Buses, and ADA Compliant Paratransit Vehicles in Bradenton Florida and Services the Southeast US
1610 A 12th Street East,. Palmetto, FL 34221–6431. Ndash; Ext. 2. Ndash; Ext. 3. Bus Sales up to 45 Passengers. We are one of the Southeast's premium providers of tour, charter, shuttle vans, mini and medium duty buses, ADA compliant paratransit vehicles and accessible low floor. Come see what we have to offer ». Parts Product Lines Offered By Getaway Bus. Getaway announces Merger with National. GetawayBus Awarded new TRIPS Contract! Getaway Marketing Launches New Website!
getawaybus.com 1303220. Getaway
Experience a unique inexpensive bush veld Holiday ( self catering ). Sleeps 2 to 10 guests. House sleeps 6 , Cottage sleeps 4 guests, ideal for 8 adults and 2 children. If you do not require the cottage IT REMAINS EMPTY FOR THE DURATION OF YOUR STAY. You are private and do not share accommodation / facilities with other guests. The Crocodile River is close to the house, about 100m to view any of the Big 5 drinking or bathing in the River / Kruger National Park. Experiencing a true feeling of Africa.
getawaybush.co.za 1303221. getawaybusoutofportland.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
getawaybusoutofportland.com 1303222. Australian Tour Search • Getaway Byron Bay
Kata Tjuta (The Olgas). Mount Warning National Park. Mt Buffalo National Park. Myall Lakes National Park. Outer Barrier Reef Pontoon. Palm Beach - (Summer Bay). Charter (Exclusive Use/Private Tour). Four Wheel Drive (4WD). Small Group Tour (16 people or less). Australian Hot Deals ». View Options ». Book Instantly Online to secure your tour today! Looking for the best value prices on fun things to do? View Hot Deals ». Want to receive updates and tour specials? If vars.bookings= ' ]. Tours to go on.
getawaybyronbay.tourstogo.com.au 1303223. GetawayCA: Find Your Next California Getaway - Make California Yours
San Francisco Bay Area/Napa Valley. News & Features. Plan Your CA Trip. Terms of Use/Privacy Policy. Dreaming of getting away? Your California vacation begins here. Northern California Northern California has it all. Its stunning landscapes – from majestic snow-capped mountains to rolling wine vineyards to breathtaking seaside escapes – and vibrant culture – an eclectic mix of. There are plenty of travel websites out there – some good, some bad. How does GetawayCA stand out? News & Features. California w...
getawayca.com 1303224. getawaycabin.com
The domain getawaycabin.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
getawaycabin.com 1303225. Getaway Cabins® | Hocking Hills Cabins and Cottages
Call Us : 740-385-3734. Find the Ideal Cabin. All Cabins: Sleeps 2. All Cabins: Sleeps 4 - 10. Sunflower Chateau, Cabin #2. Guest Nest, Cabin #3. Butterfly Bungalow, Cabin #4. Lady Bug Loft, Cabin #6. Bearadise Cove, Cabin #8. American Hollow, Cabin #9. Honeybee Hideaway, Cabin #11. Cuddle-in, Cabin #13. Stargazer, Cabin #14. Whitetail Retreat, Cabin #15. Tumbleweed, Cabin #18. The Homestead, Cabin #20. Hummingbird Haven, Cabin #21. Fox Run, Cabin #22. The Retreat, Cabin #23. Whiskey, Cabin #30. Welcome ...
getawaycabins.com 1303226. Coming Soon
Future home of something quite cool. If you're the site owner. To launch this site. If you are a visitor.
getawaycabinshockinghills.com 1303227. Bar and Grill Located in the South Hills of Pittsburgh
Getaway from cooking dinner. greasy fast food. and boring chains. Getaway with the entire family. good friends. a favorite couple or a first date. Getaway to a neighborhood café that offers an award-winning menu. delicious homemade favorites. a relaxing atmosphere. a full-service bar and excellent service. Getaway from the ordinary and enjoy an extraordinary lunch, dinner or dessert at The Getaway Café. About The Getaway Cafe. The current owner, Chuck Drago, took over The Getaway Café in June 2017.
getawaycafe.com 1303228. Getaway Cafe Restaurant in Lake Tahoe - The Getaway Cafe
Great Food, Affordable Prices. Made from scratch with love. May your meal be enhanced by the friendly banter of an attentive staff. Everything is made fresh to order in a very small kitchen so sit back, relax and enjoy the conversations of the guests you are dining with. I promise you it will be worth the wait. What’s on the menu. Three slices of coconut-crusted thick sliced sourdough, topped with fresh bananas and our amazingly-rich homemade coconut cream sauce. People love our food. See what they say.
getawaycafetahoe.com 1303229. Getaway Cafe @ UCR
Getaway Cafe @ UCR. Located in Bannockburn Village. Located in Bannockburn Village. Getaway Cafe was established in 1996. Check out Getaway Cafe on Yelp. 99;ontact@getawaycafeucr.com. 3615 Canyon Crest Drive. Riverside, CA. 92507. Located in Bannockburn Village. Getaway Cafe @ UCR. Proudly powered by WordPress.
getawaycafeucr.com 1303230. Getaway Cairns
GET IT DIRECT and SAVE 5%. Use the promo code. BOOK NOW PAY LATER SAVE 5%. EARLY BIRD DISCOUNTS $. BOOK DIRECT and SAVE. 61 (07) 4052 1200. TV and FOXTEL GUIDE. SIGN UP FOR NEWSLETTER. BOOK DIRECT and SAVE. Cairns holiday apartments located on the CBD fringe. Spacious apartments Self-catering facilities, Heated Pool, BBQ facilities, secure gated property. Close to shops, restaurants and a short walk to the Esplanade. We stayed in one of the two bedroom apartments and we were happy with our stay. The ...
getawaycairns.com.au 1303231. Save on local Cairns Reef Trips, Rainforest Tours, and Accommodation.
Call us toll-free: 1800 807 730. Middot; Outside Australia: 61 7 4051 4066. Visit the Great Barrier Reef! Shop Tours by Style. 2 Day Michaelmas Cay &. Save up to $234pp. Browse these tours recommended for you:. Hartleys Creek Crocodile Adventures - Admission. Tropical Horizons - Cape Tribulation. Reef Experience - Reef Cruise. Get your copy of the 10 of the Best. Things to do in Cairns! 1 Enter your email address. 2 Click download to receive your free. Guide to the best tours in Cairns! Take in the views.
getawaycairns.standbycairns.com 1303232. Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
getawaycalifornia.com 1303233. Get-a-way Camper Rentals for Sam A. Baker and Clearwater Lake MO
Our Campers and Rates. Starner Camping and Stables, LLC. When you want to go camping but don't have a way. Get-A-Way Camper Rentals, LLC is a small family owned business. Our goal is to provide quality rental campers to families so that they can enjoy the camping experience. Is my vehicle big enough to tow the camper? Do I need a brake controller for the camper? Will my insurance cover the camper? Am I comfortable driving a large camper over curvy, hilly, unfamiliar roads? Below is a map to Starner Campi...
getawaycamper.com 1303234. Getaway Camper Rentals
Ditch the tent and rent a camper for your next outdoor adventure! Do you love to camp, but don't like the idea of roughing it in a tent? The solution is a camper. But, owning and maintaining your own camper can be expensive. Let's face it, they are not cheap to buy, maintain, and store. But, when you rent a camper from GetAwayRentals, you can enjoy the camping experience for a fraction of the cost and time if you were to own your own! Look no further than Getaway Camper Rentals. Renting a camper. To see ...
getawaycamperrentals.com 1303235. UK camper hire, campervan rental UK | Getaway Campers
UK Camper Hire and Campervan Rental UK. Getaway Campers specialises in providing a fun, flexible and budget orientated UK camper hire experience. With your campervan rental uk you'll have the freedom to make the most of all the sights and sounds of the UK and Europe. Airport, get in touch with us! A camper will provide a simple solution to both your transport and accommodation needs. GetawayCampers.co.uk Web design.
getawaycampers.co.nz 1303236. UK camper hire, Campervan hire London, Motorhome hire UK - from Getaway
NEW FOR 2018 - We have some updated Toyota Alphards , These feature TWIN side doors and a larger capacity Fridge/Freezer. Ask for more details. UK Camper Van Hire. Getaway Campers take great pleasure in providing a flexible, fun and low cost UK camper hire. Experience. With your Campervan you'll have the freedom to make the most of all the great sights and sounds of Europe and the UK. We even accept Pets! Getaway to music festivals such as Glastonbury Music Festival. And design by Twiik links.
getawaycampers.co.uk 1303237. UK camper hire, campervan rental UK | Getaway Campers
UK Camper Hire and Campervan Rental UK. Getaway Campers specialises in providing a fun, flexible and budget orientated UK camper hire experience. With your campervan rental uk you'll have the freedom to make the most of all the sights and sounds of the UK and Europe. Car rally's, city events or just the peaceful outdoors. If you've just touched down at Heathrow. Airport, get in touch with us! A camper will provide a simple solution to both your transport and accommodation needs.
getawaycampers.com.au 1303238. Camper huren - Campers
Campers Verhuur, verkoop. Steeds meer mensen die er voor kiezen om een reis te boeken maken de bewuste keuze om een camper te huren. Een camper huren is een ideale manier om een land te ontdekken en haar cultuur te leren kennen. Ben je van plan om ook een reis te maken naar het buitenland en wil je tijdens die reis graag genieten van een ongekende vrijheid? In dat geval is een camper huren voor jou ongetwijfeld een interessante keuze! Goedkoop een camper huren. Camper huren in het buitenland. The Nationa...
getawaycampers.nl 1303239. Georgia Campground on the Altamaha River, visit Getaway Campground Georgia’s kayaking, canoeing, fishing, hunting and camping. Big Hammock a Ga. Wildlife Management Area, WMA fo - Home
Georgia Campground on the Altamaha River, visit Getaway Campground Georgia’s kayaking, canoeing, fishing, hunting and camping. Big Hammock a Ga. Wildlife Management Area, WMA fo. Contact campground for reservations. Or call 912 256 4114 or 912-256-7118. The beautiful Altamaha River. The Altamaha River is one of the great natural treasures of the eastern United States, flowing undammed for its entire length. Sun, sand and lotion. View of swamp and river from air. Reptiles such as alligators and a variety ...
getawaycampground.com 1303240. Home
Welcome To Our Site! Welcome to Getaway Camp. We are located in a remote location in the North. It is approximately a 2 1/2 hour drive past Capreol, Ontario. You can also arrive by Via Rail which is approximately 1 hour train ride from Capreol.We have a bunk house fully equipped to sleep 14. We also have a 2 bedroom cabin also fully equipped. You can rent boats and motors on the premises,. There is access to many Walleye, Northern Pike and Bass Lakes as well as our own Thor Lake.
getawaycampthorlake.com 1303241. getawaycanada.com Is For sale
Getawaycanada.com is for sale and can be yours TODAY. If interested in acquiring this domain, you can acquire it in CAD through MyID.ca Domain Marketplace HERE. If you prefer to pay USD and use escrow.com, you may contact us directly by following these simple 3 steps: 1) Send us an offer using CIRA contact us form. 2) We agree on a fair price 3) You start a transaction with escrow.com. Once funds are received, domain is yours.
getawaycanada.com 1303242. Bus in comfort your way, explore Canada|Getaway Canada Vacations
The best way to find the bus suitable for your group. -. We make it easy to get the best Quote!
getawaycanadavacations.com 1303243. Home | GETAWAYCAR
Shark Week has bite. Do you love my hair? 2017 GETAWAYCAR PRODS. LLC 323-393-3488 driver@getawaycar.com.
getawaycar.com 1303244. Campervan Rental & Camping Hire - Getaway Caravans
Who are Getaway Caravans. GETAWAY CARAVAN and CAMPING HIRE. Start a holiday with our getaway caravans and choose your own adventure! Adventure doesn’t need a destination – Wherever you are, that’s where you’ll be! As outdoor and travel enthusiasts, we started Getaway Caravan and Camping Hire on the dream of helping people enjoy their holidays with their families. We’d like to make it easier on you. The stress of planning a holiday can sometimes make the holiday itself redundant! Our campervans come ready...
getawaycaravanandcampinghire.com.au 1303245. Getaway Caravan Hire
Adelaide, South Australia. Eagle Tourer - sleeps up to 6. Eagle Outback - sleeps up to 6. Expanda 14.44-4 - sleeps up to 4. Expanda 16.49.4 - sleeps up to 6. Starcraft 17.58-1 - sleeps up to 5. Book a Van/ Contact Us. Getaway's New Caravan Hire. Why Hire a Caravan? Items included in the Hire. And Terms and Conditions. Treat yourself to a Getaway. Header Photo: Granite Island looking back to Victor Harbor. Expanda 16.49.4.
getawaycaravanhire.com.au 1303246. Discount Vacation Packages, Travel Deals, Expert Advice and Special Travel Offers... Save time and money!
Connect with Travel Agent Experts for EVERY. Type of Travel and Destination Worldwide! TripBlip - Deal Alerts. Signup For Deal Alerts.
getawaycard.com 1303247. Will Brenton Holding 1
getawaycarfilms.com 1303248. Get-a-Way Car Hire - Home
Welcome to Get-a-Way Car Hire. We are proud to introduce our personally owned business, Get-a-Way Car Hire, to you. Our aim is to provide an excellent service whilst saving you money. In order to save you money, we run our business with no frills. We endeavour to make your car hire experience a pleasant one, with the hope that you will recommend us to your friends, family and acquaintances. We cater for all car hire requirements and also do weekly, monthly and long term car hire. Life is meant to be fun.
getawaycarhire.co.za 1303249. Home - Event planning companies
Home - Event planning companies. Home - Event planning companies. Learn more about event planning companies.
getawaycaribbean.com 1303250. Main Line Singers
Great to see you. Thanks for popping in! Main Line Singers is a new community chorus based on the Main Line in the beautiful suburbs of Philadelphia. We are focused on performing a fun and accessible repertoire drawn from Broadway, Hollywood, and popular music. Our mission is to enhance our community through music - and by being totally awesome people in general! A chorus brings incredible health benefits to the singers, enrichment to the listeners and joy and education to all! Of ability who . Join in t...
getawaycarr.com 1303251. InMotion Hosting
Your IP is 66.160.134.2.
getawaycarrentals.com 1303252. Getaway Cars » Voor elke gelegenheid een unieke auto
Voor elke gelegenheid een unieke auto. Welcome to Getaway Cars! Mijn naam is Martin van der Zeijden en samen met mijn familie zijn wij gek van oldtimers! Zoeken op de site. Blijf op de hoogte van bedrijfsnieuws en ontwikkelingen! 2224 DA Katwijk (Bollenstreek). Tel 06 - 40488832.
getawaycars.nl 1303253. Non-Existent Domain
Your browser does not support iframes, please click here.
getawaycash.com 1303254. Home
Welcome to Getaway CateringLLC. Let us plan and cater the event of your Dreams. Weddings, Parties, and More. For many years we have been a full service catering company. When you want the job done right we are your answer. We make every celebration extraordinary and help you create cherished memories with personalized service, unsurpassed cuisine and meticulous attention to detail. From simple to extravagant, you will experience excellence.
getawaycatering.com 1303255. Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - cheap web hosting - Frontpage Hosting E-Commerce Web Hosting Bluehost
Web Hosting - courtesy of www.bluehost.com.
getawaycation.com 1303256. This site is under development
This site is under development. This page indicates the webmaster has not uploaded a website to the server. For information on how to build or upload a site, please visit your web hosting company's site.
getawaycay.com 1303257. This site is under development
Error Page cannot be displayed. Please contact your service provider for more details. (18).
getawaycay.net 1303258. This site is under development
Error Page cannot be displayed. Please contact your service provider for more details. (15).
getawaycay.org 1303259. Getaway CEO - Getaways
The CEO of Getaways. Owned and Operated by. Featured and basic information. Pages will be created when 1st page ad/posting/listing is placed. City and County pages will be created when 1st page ad is placed. Deal of the Day CEO. Deals of the Day CEO. Things to Do CEO. Things To See CEO. LocalZZ - Local Directories. Welcome to Getaway CEO! Getaway CEO provides a website where people can find. GetawayCEO.com's currently approved ad categories:. Featured and basic listings. City and county page listings.
getawayceo.com 1303260. Getaway CFO - Getaways
MyLocalzz - 200 Sites. The CFO of Getaways. Enter Topic and City, State. Enter Topic and City, State. Owned and Operated by. Featured and basic information. Pages will be created when 1st page ad/posting/listing is placed. City and County pages will be created when 1st page ad is placed. Businesses For Sale CFO. Deal of the Day CFO. Deals of the Day CFO. For Sale By Owner CFO. For Sales By Owners CFO. Welcome to Getaway CFO! Getaway CFO provides a website where people can find. Featured and basic listings.
getawaycfo.com 1303261. Poconos Near Big Boulder- Get Away Chalet in Albrightsville, PA
Poconos Near Big Boulder- Get Away Chalet. 187 Penn Forest Trail. Albrightsville PA 18210 US. Phone: 610-357-7755 or 610-622-4455. Web: http:/ getawaychalet.com. Rentals at Towamensing Trails, Albrightsville near Big Boulder Ski Resort. Mail to Owner's at: DCI Products c/o Mr. Jack Henderson 415 S. Penn Street Clifton Heights, PA 19018 Call: 800-622-4455 ask for Jack email: jhenderson@dciproducts.com. Eastern Standard Time (GMT -5.0). Review our Privacy Policy.
getawaychalet.com 1303262. Getaway Chalet & Bunkhouse-Vacation Rental Cabin, Crystal River Cabins, Greenwater Crystal Mountain, Mount Rainier, Washington State, United States
Everyday 9AM-7PM PST USA. Vacation Rental Cabin, Greenwater Crystal Mountain, Mount Rainier, Washington State, USA. Quote or Book Online. Remember, you can quote or book this and many units online immediately. Click on the Calendar. Or telephone us at 866-925-7086 for further assistance. The Getaway Chalet is a wonderful secluded property for a large group or a quiet getaway. Hence the name! Picturesque views surround this chalet and bunkhouse. The kitchen is roomy enough for family cooking fun! Our fami...
getawaychaletbunkhouse.com 1303263. Getawaychallenge.com - Welcome to getawaychallenge.com
Join our exclusive community of like minded people on getawaychallenge.com. We will never rent, sell or share your email to a third party. Check out our newest challenges today. Are you the type a challenge wrangler? Come and Join us at Getawaychallenge.com. It'll be fun. Win Prizes and Equity Points. Great Free Prizes or Getawaychallenge.com Equity awaits our challenge winners. Submit mobile apps that could run our mobile vertical. We have over 265 brands that has over 50k. Once your partnership proposa...
getawaychallenge.com 1303264. GetAway Charter | Douglas, GA 31534
Designed using Homestead website templates. Create a website today. Were committed to helping you. Affordable, comfortable, reliable, safe and professional motorcoach charter service. For any group, going anywhere. Contact us for your next trip now! If youre looking for high quality and personal service, youve come to the right place. At GetAway Charter we’ll give you the attention and personal service youll come to expect and enjoy. Our coaches are equipped with:. Up to 30, 42 and 56 reclining seats.
getawaycharter.com